The store will not work correctly when cookies are disabled.
JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
NDUFA1 Description NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1
Gene and Protein Information Gene ID 4694 Uniprot Accession IDs O15239 Ensembl ID ENSP00000360492 Symbol MWFE ZNF183 CI-MWFE MC1DN12 Family Belongs to the complex I NDUFA1 subunit family. Sequence MWFEILPGLSVMGVCLLIPGLATAYIHRFTNGGKEKRVAHFGYHWSLMERDRRISGVDRYYVSKGLENID
Homologous gene and protein info.
Species Gene ID Gene Symbol Name Tax ID Other Gene ID Sources Chimp 100608263 NDUFA1 NADH:ubiquinone oxidoreductase subunit A1 9598 VGNC:7461 OMA, EggNOG Macaque 694635 NDUFA1 NADH:ubiquinone oxidoreductase subunit A1 9544 Inparanoid, OMA, EggNOG Mouse 54405 Ndufa1 NADH:ubiquinone oxidoreductase subunit A1 10090 MGI:1929511 Inparanoid, OMA, EggNOG Rat 363441 Ndufa1 NADH:ubiquinone oxidoreductase subunit A1 10116 RGD:1560955 Inparanoid, OMA, EggNOG Horse 100058835 NDUFA1 NADH:ubiquinone oxidoreductase subunit A1 9796 VGNC:20620 Inparanoid, OMA, EggNOG Cow 327673 NDUFA1 NADH:ubiquinone oxidoreductase subunit A1 9913 VGNC:31944 Inparanoid, OMA, EggNOG Pig 100515069 NDUFA1 NADH:ubiquinone oxidoreductase subunit A1 9823 OMA, EggNOG Platypus 100078945 NDUFA1 NADH:ubiquinone oxidoreductase subunit A1 9258 Inparanoid, OMA, EggNOG Chicken 772150 NDUFA1 NADH:ubiquinone oxidoreductase subunit A1 9031 CGNC:6539 Inparanoid, OMA, EggNOG Anole lizard 100558312 ndufa1 NADH:ubiquinone oxidoreductase subunit A1 28377 Inparanoid, OMA, EggNOG Xenopus 100135137 ndufa1 NADH:ubiquinone oxidoreductase subunit A1 8364 XB-GENE-1008465 Inparanoid, OMA, EggNOG Zebrafish 415243 ndufa1 NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 1 7955 ZDB-GENE-040625-168 Inparanoid, OMA, EggNOG
Associated Recombinant Proteins Name Specification and purity Expression system Protein label Availability View Details
Associated Antibodies
Name Specifications Species reactivity Application Availability View Details
Associated Approved Drugs Associated Active Ligands Associated Diseases Name Direct Associated Targets Disease Type Mondoid
We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our
Cookie Policy. Settings Agree All Decline
Shall we send you a message when we have discounts available?
Remind me later Allow
Thank you! Please check your email inbox to confirm.
Oops! Notifications are disabled.
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.