NNAT

DescriptionNeuronatin

Gene and Protein Information

Gene ID4826
Uniprot Accession IDs Q16517 B2R558 E1P5V6 Q16596 Q5U0N3
Ensembl ID ENSP00000062104
Symbol Peg5
FamilyBelongs to the neuronatin family.
Sequence
MAAVAAASAELLIIGWYIFRVLLQVFLECCIYWVGFAFRNPPGTQPIARSEVFRYSLQKLAYTVSRTGRQVLGERRQRAPN
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp458231NNATneuronatin9598VGNC:14266OMA, EggNOG
Macaque700562NNATneuronatin9544OMA, EggNOG
Mouse18111Nnatneuronatin10090MGI:104716Inparanoid, EggNOG
Rat94270Nnatneuronatin10116RGD:620155Inparanoid, OMA, EggNOG
Dog609195NNATneuronatin9615VGNC:43868Inparanoid, OMA, EggNOG
Horse100055414NNATneuronatin9796VGNC:20788Inparanoid, OMA, EggNOG
Cow353114NNATneuronatin9913VGNC:32142Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.