🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

NAP1L1

DescriptionNucleosome assembly protein 1-like 1

Gene and Protein Information

Gene ID4673
Uniprot Accession IDs P55209 B3KNT8 B3KV44
Ensembl ID ENSP00000477538
Symbol NRP NRP NAP1 NAP1L
FamilyBelongs to the nucleosome assembly protein (NAP) family.
Sequence
MADIDNKEQSELDQDLDDVEEVEEEETGEETKLKARQLTVQMMQNPQILAALQERLDGLVETPTGYIESLPRVVKRRVNALKNLQVKCAQIEAKFYEEVHDLERKYAVLYQPLFDKRFEIINAIYEPTEEECEWKPDEEDEISEELKEKAKIEDEKKDEEKEDPKGIPEFWLTVFKNVDLLSDMVQEHDEPILKHLKDIKVKFSDAGQPMSFVLEFHFEPNEYFTNEVLTKTYRMRSEPDDSDPFSFDGPEIMGCTGCQIDWKKGKNVTLKTIKKKQKHKGRGTVRTVTKTVSNDSFFNFFAPPEVPESGDLDDDAEAILAADFEIGHFLRERIIPRSVLYFTGEAIEDDDDDYDEEGEEADEEGEEEGDEENDPDYDPKKDQNPAECKQQ
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp452083NAP1L1nucleosome assembly protein 1 like 19598VGNC:8471OMA, EggNOG
Macaque719047NAP1L1nucleosome assembly protein 1 like 19544Inparanoid, OMA
Macaque706480LOC706480nucleosome assembly protein 1-like 19544OMA, EggNOG
Mouse53605Nap1l1nucleosome assembly protein 1-like 110090MGI:1855693Inparanoid, OMA, EggNOG
Rat89825Nap1l1nucleosome assembly protein 1-like 110116RGD:71094Inparanoid, OMA, EggNOG
Dog475407NAP1L1nucleosome assembly protein 1 like 19615Inparanoid, OMA, EggNOG
Horse100050241NAP1L1nucleosome assembly protein 1 like 19796VGNC:20557Inparanoid, OMA, EggNOG
Cow790872NAP1L1nucleosome assembly protein 1 like 19913Inparanoid, OMA, EggNOG
Pig100524086NAP1L1nucleosome assembly protein 1 like 19823Inparanoid, OMA, EggNOG
Opossum100012744NAP1L1nucleosome assembly protein 1 like 113616OMA, EggNOG
Chicken417864NAP1L1nucleosome assembly protein 1 like 19031CGNC:50609Inparanoid, OMA
Anole lizard100566103nap1l1nucleosome assembly protein 1 like 128377Inparanoid, OMA
Xenopus407956nap1l1nucleosome assembly protein 1 like 18364XB-GENE-484197Inparanoid, OMA
Zebrafish368260nap1l1nucleosome assembly protein 1-like 17955ZDB-GENE-030516-2Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    enzyme modulator    /    phosphatase inhibitor    /    Nucleosome assembly protein 1-like 1
DTO Classes
protein    /    Enzyme modulator    /    Phosphatase modulator    /    Phosphatase inhibitor    /    Nucleosome assembly protein 1-like 1

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.