🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

NCEH1

DescriptionNeutral cholesterol ester hydrolase 1

Gene and Protein Information

Gene ID57552
Uniprot Accession IDs Q6PIU2 B7Z2K4 B7Z3A1 B7Z5U2 B7Z906 B7ZAW6 F5H7K4 Q86WZ1 Q9P2I4 NCEH
Ensembl ID ENSP00000442464
Symbol AADACL1 KIAA1363 NCEH AADACL1
FamilyBelongs to the 'GDXG' lipolytic enzyme family.
Sequence
MRSSCVLLTALVALAAYYVYIPLPGSVSDPWKLMLLDATFRGAQQVSNLIHYLGLSHHLLALNFIIVSFGKKSAWSSAQVKVTDTDFDGVEVRVFEGPPKPEEPLKRSVVYIHGGGWALASAKIRYYDELCTAMAEELNAVIVSIEYRLVPKVYFPEQIHDVVRATKYFLKPEVLQKYMVDPGRICISGDSAGGNLAAALGQQFTQDASLKNKLKLQALIYPVLQALDFNTPSYQQNVNTPILPRYVMVKYWVDYFKGNYDFVQAMIVNNHTSLDVEEAAAVRARLNWTSLLPASFTKNYKPVVQTTGNARIVQELPQLLDARSAPLIADQAVLQLLPKTYILTCEHDVLRDDGIMYAKRLESAGVEVTLDHFEDGFHGCMIFTSWPTNFSVGIRTRNSYIKWLDQNL
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp470998NCEH1neutral cholesterol ester hydrolase 19598VGNC:11989OMA, EggNOG
Macaque694200NCEH1neutral cholesterol ester hydrolase 19544Inparanoid, OMA, EggNOG
Mouse320024Nceh1neutral cholesterol ester hydrolase 110090MGI:2443191Inparanoid, OMA, EggNOG
Rat294930Nceh1neutral cholesterol ester hydrolase 110116RGD:1311104Inparanoid, OMA, EggNOG
Dog488171NCEH1neutral cholesterol ester hydrolase 19615VGNC:43649Inparanoid, OMA, EggNOG
Horse100064432NCEH1neutral cholesterol ester hydrolase 19796VGNC:20585Inparanoid, OMA, EggNOG
Cow534212NCEH1neutral cholesterol ester hydrolase 19913VGNC:31911Inparanoid, OMA, EggNOG
Pig100154209NCEH1neutral cholesterol ester hydrolase 19823Inparanoid, OMA, EggNOG
Opossum100010391NCEH1neutral cholesterol ester hydrolase 113616Inparanoid, OMA, EggNOG
Chicken429158NCEH1neutral cholesterol ester hydrolase 19031CGNC:6974OMA, EggNOG
Anole lizard100566353nceh1neutral cholesterol ester hydrolase 128377Inparanoid, OMA, EggNOG
Zebrafish432374nceh1aneutral cholesterol ester hydrolase 1a7955ZDB-GENE-040711-2Inparanoid, OMA
Zebrafish777713nceh1b.1neutral cholesterol ester hydrolase 1b, tandem duplicate 17955ZDB-GENE-061110-43OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    hydrolase    /    serine protease    /    Neutral cholesterol ester hydrolase 1
protein    /    hydrolase    /    lipase    /    Neutral cholesterol ester hydrolase 1
DTO Classes
protein    /    Enzyme    /    Hydrolase    /    Lipase    /    Neutral cholesterol ester hydrolase 1

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.