224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | NKG2-D type II integral membrane protein |
|---|
Gene and Protein Information
| Gene ID | 100528032 |
|---|---|
| Uniprot Accession IDs | P26718 A8K7K5 A8K7P4 Q9NR41 |
| Ensembl ID | ENSP00000240618 |
| Symbol | D12S2489E NKG2D |
| Sequence | MGWIRGRRSRHSWEMSEFHNYNLDLKKSDFSTRWQKQRCPVVKSKCRENASPFFFCCFIAVAMGIRFIIMVAIWSAVFLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTV |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 450153 | KLRK1 | killer cell lectin like receptor K1 | 9598 | VGNC:52050 | Inparanoid, OMA, EggNOG |
| Macaque | 574240 | NKG2D | NKG2D protein | 9544 | Inparanoid, OMA | |
| Mouse | 27007 | Klrk1 | killer cell lectin-like receptor subfamily K, member 1 | 10090 | MGI:1196250 | Inparanoid, OMA, EggNOG |
| Rat | 24934 | Klrk1 | killer cell lectin like receptor K1 | 10116 | RGD:3180 | Inparanoid, OMA |
| Dog | 611355 | KLRK1 | killer cell lectin like receptor K1 | 9615 | Inparanoid, OMA, EggNOG | |
| Horse | 100053963 | KLRK1 | killer cell lectin like receptor K1 | 9796 | VGNC:52401 | Inparanoid, OMA, EggNOG |
| Cow | 404058 | KLRK1 | killer cell lectin-like receptor subfamily K, member 1 | 9913 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.