🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

NDUFB2

DescriptionNADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial

Gene and Protein Information

Gene ID4708
Uniprot Accession IDs O95178 Q6FGI6
Ensembl ID ENSP00000419087
Symbol AGGG CI-AGGG
FamilyBelongs to the complex I NDUFB2 subunit family.
Sequence
MSALTRLASFARVGGRLFRSGCARTAGDGGVRHAGGGVHIEPRYRQFPQLTRSQVFQSEFFSGLMWFWILWRFWHDSEEVLGHFPYPDPSQWTDEELGIPPDDED
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp463780NDUFB2NADH:ubiquinone oxidoreductase subunit B29598VGNC:4441Inparanoid, OMA, EggNOG
Macaque693431NDUFB2NADH:ubiquinone oxidoreductase subunit B29544Inparanoid, OMA, EggNOG
Mouse68198Ndufb2NADH:ubiquinone oxidoreductase subunit B210090MGI:1915448Inparanoid, OMA, EggNOG
Rat362344Ndufb2NADH:ubiquinone oxidoreductase subunit B210116RGD:1308130Inparanoid, OMA, EggNOG
Dog100683846NDUFB2NADH:ubiquinone oxidoreductase subunit B29615VGNC:43701Inparanoid, OMA, EggNOG
Horse100064695NDUFB2NADH:ubiquinone oxidoreductase subunit B29796VGNC:20638Inparanoid, OMA, EggNOG
Cow327713NDUFB2NADH:ubiquinone oxidoreductase subunit B29913VGNC:31962Inparanoid, OMA, EggNOG
Pig100513895NDUFB2NADH:ubiquinone oxidoreductase subunit B29823Inparanoid, EggNOG
OpossumNDUFB2NADH:ubiquinone oxidoreductase subunit B2 [Source:HGNC Symbol;Acc:HGNC:7697]13616Inparanoid, OMA, EggNOG
Anole lizard100559985ndufb2NADH:ubiquinone oxidoreductase subunit B228377Inparanoid, OMA, EggNOG
Xenopus100127720ndufb2NADH:ubiquinone oxidoreductase subunit B28364XB-GENE-1009607Inparanoid, EggNOG
Zebrafish393764ndufb2NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 27955ZDB-GENE-040426-1762OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.