🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

NME4

DescriptionNucleoside diphosphate kinase, mitochondrial

Gene and Protein Information

Gene ID4833
Uniprot Accession IDs O00746 A2IDD0 Q5U0M9 NDK
Ensembl ID ENSP00000219479
Symbol NM23D NDPK-D NM23H4 nm23-H4
FamilyBelongs to the NDK family.
Sequence
MGGLFWRSALRGLRCGPRAPGPSLLVRHGSGGPSWTRERTLVAVKPDGVQRRLVGDVIQRFERRGFTLVGMKMLQAPESVLAEHYQDLRRKPFYPALIRYMSSGPVVAMVWEGYNVVRASRAMIGHTDSAEAAPGTIRGDFSVHISRNVIHASDSVEGAQREIQLWFQSSELVSWADGGQHSSIHPA
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Macaque695649NME4NME/NM23 nucleoside diphosphate kinase 49544Inparanoid, OMA, EggNOG
Mouse56520Nme4NME/NM23 nucleoside diphosphate kinase 410090MGI:1931148Inparanoid, OMA, EggNOG
Horse100066649NME4NME/NM23 nucleoside diphosphate kinase 49796VGNC:51174Inparanoid, OMA, EggNOG
Cow789324NME4NME/NM23 nucleoside diphosphate kinase 49913Inparanoid, EggNOG
Pig100233195NME4NME/NM23 nucleoside diphosphate kinase 49823Inparanoid, OMA, EggNOG
Opossum103101146NME4NME/NM23 nucleoside diphosphate kinase 413616Inparanoid, OMA, EggNOG
Chicken395915NME4NME/NM23 nucleoside diphosphate kinase 49031OMA, EggNOG
Xenopus734101nme4NME/NM23 nucleoside diphosphate kinase 48364XB-GENE-5926500Inparanoid, OMA, EggNOG
Zebrafish394170nme4NME/NM23 nucleoside diphosphate kinase 47955ZDB-GENE-040426-1043Inparanoid, OMA, EggNOG

Protein Classes

DTO Classes
protein    /    Kinase    /    Unclassified protein    /    Nucleoside diphosphate kinase, mitochondrial

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.