🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

NDUFB8

DescriptionNADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial

Gene and Protein Information

Gene ID4714
Uniprot Accession IDs O95169 A8K0L4 Q5W143 Q5W144 Q5W145 Q9UG53 Q9UJR4 Q9UQF3
Ensembl ID ENSP00000299166
Symbol ASHI CI-ASHI MC1DN32
FamilyBelongs to the complex I NDUFB8 subunit family.
Sequence
MAVARAGVLGVQWLQRASRNVMPLGARTASHMTKDMFPGPYPRTPEERAAAAKKYNMRVEDYEPYPDDGMGYGDYPKLPDRSQHERDPWYSWDQPGLRLNWGEPMHWHLDMYNRNRVDTSPTPVSWHVMCMQLFGFLAFMIFMCWVGDVYPVYQPVGPKQYPYNNLYLERGGDPSKEPERVVHYEI
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp744716NDUFB8NADH:ubiquinone oxidoreductase subunit B89598VGNC:12384Inparanoid, OMA, EggNOG
Mouse67264Ndufb8NADH:ubiquinone oxidoreductase subunit B810090MGI:1914514Inparanoid, OMA, EggNOG
Rat293991Ndufb8NADH:ubiquinone oxidoreductase subunit B810116RGD:1309129Inparanoid, OMA, EggNOG
Dog477798NDUFB8NADH:ubiquinone oxidoreductase subunit B89615VGNC:53001Inparanoid, OMA
Cow282517NDUFB8NADH:ubiquinone oxidoreductase subunit B89913Inparanoid, OMA
Chicken423763NDUFB8NADH:ubiquinone oxidoreductase subunit B89031CGNC:4254Inparanoid, OMA
Zebrafish393829ndufb8NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 87955ZDB-GENE-040426-1858Inparanoid, OMA

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.