The store will not work correctly when cookies are disabled.
JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
NDUFA3 Description NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3
Gene and Protein Information Gene ID 4696 Uniprot Accession IDs O95167 Ensembl ID ENSP00000418438 Symbol B9 CI-B9 Family Belongs to the complex I NDUFA3 subunit family. Sequence MAARVGAFLKNAWDKEPVLVVSFVVGGLAVILPPLSPYFKYSVMINKATPYNYPVPVRDDGNMPDVPSHPQDPQGPSLEWLKKL
Homologous gene and protein info.
Species Gene ID Gene Symbol Name Tax ID Other Gene ID Sources Chimp 100614219 NDUFA3 NADH:ubiquinone oxidoreductase subunit A3 9598 VGNC:11198 Inparanoid, OMA, EggNOG Mouse 66091 Ndufa3 NADH:ubiquinone oxidoreductase subunit A3 10090 MGI:1913341 Inparanoid, OMA Rat 680288 LOC680288 similar to NADH-ubiquinone oxidoreductase B9 subunit (Complex I-B9) (CI-B9) 10116 RGD:1594144 Inparanoid, OMA Horse 100052169 NDUFA3 NADH:ubiquinone oxidoreductase subunit A3 9796 VGNC:20624 Inparanoid, OMA Opossum 100028584 NDUFA3 NADH:ubiquinone oxidoreductase subunit A3 13616 Inparanoid, OMA Anole lizard 103279923 ndufa3 NADH:ubiquinone oxidoreductase subunit A3 28377 Inparanoid, OMA Xenopus 549801 ndufa3 NADH:ubiquinone oxidoreductase subunit A3 8364 XB-GENE-1006323 Inparanoid, OMA
Associated Recombinant Proteins Name Specification and purity Expression system Protein label Availability View Details
Associated Antibodies
Name Specifications Species reactivity Application Availability View Details
Associated Approved Drugs Associated Active Ligands Associated Diseases Name Direct Associated Targets Disease Type Mondoid
We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our
Cookie Policy. Settings Agree All Decline
Shall we send you a message when we have discounts available?
Remind me later Allow
Thank you! Please check your email inbox to confirm.
Oops! Notifications are disabled.
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.