224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial |
|---|
Gene and Protein Information
| Gene ID | 4722 |
|---|---|
| Uniprot Accession IDs | O75489 B2R9J1 B4DFM8 Q9UNQ8 |
| Ensembl ID | ENSP00000263774 |
| Symbol | CI-30 MC1DN8 |
| Family | Belongs to the complex I 30 kDa subunit family. |
| Sequence | MAAAAVARLWWRGILGASALTRGTGRPSVLLLPVRRESAGADTRPTVRPRNDVAHKQLSAFGEYVAEILPKYVQQVQVSCFNELEVCIHPDGVIPVLTFLRDHTNAQFKSLVDLTAVDVPTRQNRFEIVYNLLSLRFNSRIRVKTYTDELTPIESAVSVFKAANWYEREIWDMFGVFFANHPDLRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVKRVVAEPVELAQEFRKFDLNSPWEAFPVYRQPPESLKLEAGDKKPDAK |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 451175 | NDUFS3 | NADH:ubiquinone oxidoreductase core subunit S3 | 9598 | VGNC:6492 | Inparanoid, OMA, EggNOG |
| Macaque | 713104 | PTPMT1 | protein tyrosine phosphatase, mitochondrial 1 | 9544 | Inparanoid, OMA | |
| Mouse | 68349 | Ndufs3 | NADH:ubiquinone oxidoreductase core subunit S3 | 10090 | MGI:1915599 | Inparanoid, OMA, EggNOG |
| Rat | 295923 | Ndufs3 | NADH:ubiquinone oxidoreductase core subunit S3 | 10116 | RGD:1309406 | Inparanoid, OMA, EggNOG |
| Dog | 475978 | NDUFS3 | NADH:ubiquinone oxidoreductase core subunit S3 | 9615 | VGNC:43708 | Inparanoid, OMA, EggNOG |
| Horse | 100058223 | NDUFS3 | NADH:ubiquinone oxidoreductase core subunit S3 | 9796 | VGNC:20645 | Inparanoid, OMA, EggNOG |
| Cow | 287327 | NDUFS3 | NADH:ubiquinone oxidoreductase core subunit S3 | 9913 | VGNC:50228 | Inparanoid, OMA, EggNOG |
| Opossum | 100016907 | NDUFS3 | NADH:ubiquinone oxidoreductase core subunit S3 | 13616 | Inparanoid, OMA, EggNOG | |
| Platypus | NDUFS3 | NADH:ubiquinone oxidoreductase core subunit S3 [Source:HGNC Symbol;Acc:HGNC:7710] | 9258 | OMA, EggNOG | ||
| Chicken | 423179 | NDUFS3 | NADH:ubiquinone oxidoreductase core subunit S3 | 9031 | CGNC:6122 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100555578 | ndufs3 | NADH:ubiquinone oxidoreductase core subunit S3 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 394690 | ndufs3 | NADH:ubiquinone oxidoreductase core subunit S3 | 8364 | XB-GENE-997488 | Inparanoid, OMA, EggNOG |
| Zebrafish | 550451 | ndufs3 | NADH dehydrogenase (ubiquinone) Fe-S protein 3, (NADH-coenzyme Q reductase) | 7955 | ZDB-GENE-050417-274 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.