224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Myeloid differentiation primary response protein MyD88 |
|---|
Gene and Protein Information
| Gene ID | 4615 |
|---|---|
| Uniprot Accession IDs | Q99836 B4DKH8 B4DKU4 B4DQ60 B4DQ72 J3KPU4 J3KQ87 J3KQJ6 P78397 Q53XS7 |
| Ensembl ID | ENSP00000401399 |
| Symbol | MYD88D |
| Sequence | MAAGGPGAGSAAPVSSTSSLPLAALNMRVRRRLSLFLNVRTQVAADWTALAEEMDFEYLEIRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGPSIEEDCQKYILKQQQEEAEKPLQVAAVDSSVPRTAELAGITTLDDPLGHMPERFDAFICYCPSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGAHQKRLIPIKYKAMKKEFPSILRFITVCDYTNPCTKSWFWTRLAKALSLP |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 460269 | MYD88 | myeloid differentiation primary response 88 | 9598 | VGNC:2434 | Inparanoid, OMA, EggNOG |
| Macaque | 696494 | MYD88 | myeloid differentiation primary response 88 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 17874 | Myd88 | myeloid differentiation primary response gene 88 | 10090 | MGI:108005 | Inparanoid, OMA, EggNOG |
| Rat | 301059 | Myd88 | myeloid differentiation primary response 88 | 10116 | RGD:735043 | Inparanoid, OMA, EggNOG |
| Dog | 477024 | MYD88 | myeloid differentiation primary response 88 | 9615 | VGNC:43531 | Inparanoid, OMA, EggNOG |
| Horse | 100053940 | MYD88 | myeloid differentiation primary response 88 | 9796 | VGNC:20472 | Inparanoid, OMA, EggNOG |
| Cow | 444881 | MYD88 | myeloid differentiation primary response 88 | 9913 | VGNC:31789 | Inparanoid, OMA, EggNOG |
| Pig | 396646 | MYD88 | myeloid differentiation primary response 88 | 9823 | Inparanoid, OMA, EggNOG | |
| Platypus | 100077067 | MYD88 | myeloid differentiation primary response 88 | 9258 | Inparanoid, EggNOG | |
| Chicken | 420420 | MYD88 | myeloid differentiation primary response 88 | 9031 | CGNC:4445 | Inparanoid, OMA |
| Anole lizard | 100561767 | myd88 | myeloid differentiation primary response 88 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 549591 | myd88 | myeloid differentiation primary response 88 | 8364 | XB-GENE-486650 | Inparanoid, OMA, EggNOG |
| Zebrafish | 403145 | myd88 | myeloid differentiation primary response 88 | 7955 | ZDB-GENE-040219-3 | Inparanoid, OMA, EggNOG |
| Fruitfly | 35956 | Myd88 | CG2078 gene product from transcript CG2078-RB | 7227 | FBgn0033402 | Inparanoid, EggNOG |
Protein Classes
PANTHER Classes
protein / enzyme modulator / kinase activator / Myeloid differentiation primary response protein MyD88
protein / enzyme modulator / kinase activator / Myeloid differentiation primary response protein MyD88
DTO Classes
protein / Enzyme modulator / Kinase modulator / Kinase activator / Myeloid differentiation primary response protein MyD88
protein / Enzyme modulator / Kinase modulator / Kinase activator / Myeloid differentiation primary response protein MyD88
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.