224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1 |
|---|
Gene and Protein Information
| Gene ID | 58190 |
|---|---|
| Uniprot Accession IDs | Q9GZU7 C9IYG0 Q7Z5Q3 Q7Z5Q4 |
| Ensembl ID | ENSP00000273062 |
| Symbol | NIF3 NLIIF SCP1 NIF3 SCP1 NLIIF NLI-IF |
| Sequence | MDSSAVITQISKEEARGPLRGKGDQKSAASQKPRSRGILHSLFCCVCRDDGEALPAHSGAPLLVEENGAIPKQTPVQYLLPEAKAQDSDKICVVIDLDETLVHSSFKPVNNADFIIPVEIDGVVHQVYVLKRPHVDEFLQRMGELFECVLFTASLAKYADPVADLLDKWGAFRARLFRESCVFHRGNYVKDLSRLGRDLRRVLILDNSPASYVFHPDNAVPVASWFDNMSDTELHDLLPFFEQLSRVDDVYSVLRQPRPGS |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 459943 | CTDSP1 | CTD small phosphatase 1 | 9598 | VGNC:1942 | OMA, EggNOG |
| Macaque | 698824 | CTDSP1 | CTD small phosphatase 1 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 227292 | Ctdsp1 | CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase 1 | 10090 | MGI:2654470 | Inparanoid, OMA, EggNOG |
| Rat | 363249 | Ctdsp1 | CTD small phosphatase 1 | 10116 | RGD:1305629 | Inparanoid, OMA, EggNOG |
| Dog | 100856365 | CTDSP1 | CTD small phosphatase 1 | 9615 | VGNC:39693 | Inparanoid, OMA |
| Cow | 516199 | CTDSP1 | CTD small phosphatase 1 | 9913 | VGNC:27790 | Inparanoid, OMA |
| Opossum | 100011458 | CTDSP1 | CTD small phosphatase 1 | 13616 | Inparanoid, OMA | |
| Zebrafish | 553744 | ctdsp1 | CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase 1 | 7955 | ZDB-GENE-050522-523 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.