224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Cannabinoid receptor 1 |
|---|
Gene and Protein Information
| Gene ID | 1268 |
|---|---|
| Uniprot Accession IDs | P21554 B2R9T4 E1P512 Q13949 Q495Z0 Q4PLI4 Q4VBM6 Q5JVL5 Q5UB37 Q9UNN0 CB-R |
| Ensembl ID | ENSP00000358513 |
| Symbol | CNR CB1 CNR CB-R CB1A CB1R CANN6 CB1K5 |
| Family | Belongs to the G-protein coupled receptor 1 family. |
| Sequence | MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMVLNPSQQLAIAVLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFIDFHVFHRKDSRNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYKRIVTRPKAVVAFCLMWTIAIVIAVLPLLGWNCEKLQSVCSDIFPHIDETYLMFWIGVTSVLLLFIVYAYMYILWKAHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILVVLIICWGPLLAIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTAQPLDNSMGDSDCLHKHANNAASVHRAAESCIKSTVKIAKVTMSVSTDTSAEAL Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 472066 | CNR1 | cannabinoid receptor 1 | 9598 | VGNC:12629 | Inparanoid, OMA |
| Macaque | 574142 | CNR1 | cannabinoid receptor 1 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 12801 | Cnr1 | cannabinoid receptor 1 (brain) | 10090 | MGI:104615 | Inparanoid, OMA, EggNOG |
| Rat | 25248 | Cnr1 | cannabinoid receptor 1 | 10116 | RGD:2369 | Inparanoid, OMA, EggNOG |
| Dog | 481913 | CNR1 | cannabinoid receptor 1 | 9615 | VGNC:39426 | Inparanoid, OMA, EggNOG |
| Horse | 100065681 | CNR1 | cannabinoid receptor 1 | 9796 | VGNC:16687 | Inparanoid, OMA, EggNOG |
| Cow | 100299449 | CNR1 | cannabinoid receptor 1 | 9913 | VGNC:27529 | Inparanoid, OMA, EggNOG |
| Pig | 100520160 | CNR1 | cannabinoid receptor 1 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100019458 | CNR1 | cannabinoid receptor 1 | 13616 | Inparanoid, OMA, EggNOG | |
| Platypus | 100076148 | CNR1 | cannabinoid receptor 1 | 9258 | Inparanoid, OMA, EggNOG | |
| Anole lizard | 100555903 | cnr1 | cannabinoid receptor 1 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 100497761 | cnr1 | cannabinoid receptor 1 (brain) | 8364 | XB-GENE-962201 | Inparanoid, OMA, EggNOG |
| Zebrafish | 404209 | cnr1 | cannabinoid receptor 1 | 7955 | ZDB-GENE-040312-3 | Inparanoid, OMA, EggNOG |
Protein Classes
DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / Cannabinoid receptor / Cannabinoid receptor 1
protein / G-protein coupled receptor / Class A rhodopsin like / Cannabinoid receptor / Cannabinoid receptor 1
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.