🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA Structure
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

DCTN5

DescriptionDynactin subunit 5

Gene and Protein Information

Gene ID84516
Uniprot Accession IDs Q9BTE1 A8K9X8 H3BN51 H3BQA4
Ensembl ID ENSP00000300087
FamilyBelongs to the dynactin subunits 5/6 family. Dynactin subunit 5 subfamily.
Sequence
MELGELLYNKSEYIETASGNKVSRQSVLCGSQNIVLNGKTIVMNDCIIRGDLANVRVGRHCVVKSRSVIRPPFKKFSKGVAFFPLHIGDHVFIEEDCVVNAAQIGSYVHVGKNCVIGRRCVLKDCCKILDNTVLPPETVVPPFTVFSGCPGLFSGELPECTQELMIDVTKSYYQKFLPLTQV
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Macaque698277DCTN5dynactin subunit 59544Inparanoid, OMA, EggNOG
Mouse59288Dctn5dynactin 510090MGI:1891689Inparanoid, OMA, EggNOG
Rat308961Dctn5dynactin subunit 510116RGD:1305654Inparanoid, OMA
Dog479804DCTN5dynactin subunit 59615VGNC:39820Inparanoid, OMA, EggNOG
Horse100068373DCTN5dynactin subunit 59796VGNC:17059Inparanoid, OMA, EggNOG
Cow506441DCTN5dynactin subunit 59913VGNC:27932OMA, EggNOG
Opossum100019570DCTN5dynactin subunit 513616Inparanoid, OMA, EggNOG
Platypus100073579DCTN5dynactin subunit 59258Inparanoid, OMA, EggNOG
Chicken416574DCTN5dynactin subunit 59031CGNC:4566Inparanoid, OMA, EggNOG
Anole lizard100563763dctn5dynactin subunit 528377Inparanoid, OMA, EggNOG
Xenopus496622dctn5dynactin subunit 58364XB-GENE-963961Inparanoid, OMA, EggNOG
Zebrafish436770dctn5dynactin 57955ZDB-GENE-040718-201Inparanoid, OMA, EggNOG
C. elegans171856dnc-5DyNactin Complex component6239Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.