🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

COX5B

DescriptionCytochrome c oxidase subunit 5B, mitochondrial

Gene and Protein Information

Gene ID1329
Uniprot Accession IDs P10606 Q53YB7 Q96J18 Q99610
Ensembl ID ENSP00000258424
Symbol COXVB
FamilyBelongs to the cytochrome c oxidase subunit 5B family.
Sequence
MASRLLRGAGTLAAQALRARGPSGAAAMRSMASGGGVPTDEEQATGLEREIMLAAKKGLDPYNVLAPKGASGTREDPNLVPSISNKRIVGCICEEDNTSVVWFWLHKGEAQRCPRCGAHYKLVPQQLAH
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp741789COX5Bcytochrome c oxidase subunit 5B9598VGNC:10525OMA, EggNOG
Mouse12859Cox5bcytochrome c oxidase subunit Vb10090MGI:88475Inparanoid, OMA
Mouse100040340Gm11273predicted gene 1127310090MGI:3649411OMA, EggNOG
Rat94194Cox5bcytochrome c oxidase subunit 5B10116RGD:620608Inparanoid, OMA, EggNOG
Dog474567COX5Bcytochrome c oxidase subunit 5B9615VGNC:39540Inparanoid, OMA, EggNOG
Horse100061973COX5Bcytochrome c oxidase subunit 5B9796VGNC:16804Inparanoid, OMA, EggNOG
Cow287012COX5Bcytochrome c oxidase subunit Vb9913Inparanoid, OMA, EggNOG
Pig492822COX5Bmitochondrial cytochrome c oxidase subunit Vb9823Inparanoid, OMA, EggNOG
Anole lizard100563950LOC100563950cytochrome c oxidase subunit 5B, mitochondrial28377Inparanoid, OMA, EggNOG
Xenopus549004cox5b.1cytochrome c oxidase subunit Vb, gene 18364XB-GENE-964002OMA, EggNOG
Zebrafish415253zgc:86599zgc:865997955ZDB-GENE-040625-180Inparanoid, OMA, EggNOG
C. elegans172832cox-5BCytochrome OXidase assembly protein6239OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    oxidoreductase    /    oxidase    /    Cytochrome c oxidase subunit 5B, mitochondrial
DTO Classes
protein    /    Enzyme    /    Oxidoreductase    /    Oxidase    /    Cytochrome c oxidase subunit 5B, mitochondrial

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.