🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

CBX3

DescriptionChromobox protein homolog 3

Gene and Protein Information

Gene ID11335
Uniprot Accession IDs Q13185 Q96CD7 Q99409 Q9BVS3 Q9P0Z6
Ensembl ID ENSP00000336687
Symbol HECH HP1-GAMMA HP1Hs-gamma
Sequence
MASNKTTLQKMGKKQNGKSKKVEEAEPEEFVVEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEAFLNSQKAGKEKDGTKRKSLSDSESDDSKSKKKRDAADKPRGFARGLDPERIIGATDSSGELMFLMKWKDSDEADLVLAKEANMKCPQIVIAFYEERLTWHSCPEDEAQ
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp463300CBX3chromobox 39598VGNC:4297OMA, EggNOG
Macaque695847LOC695847chromobox protein homolog 3-like9544OMA, EggNOG
Mouse12417Cbx3chromobox 310090MGI:108515Inparanoid, OMA, EggNOG
Dog482015CBX3chromobox 39615Inparanoid, OMA, EggNOG
Horse100054158CBX3chromobox 39796VGNC:51930Inparanoid, OMA, EggNOG
Cow539788CBX3chromobox 39913VGNC:50017Inparanoid, OMA, EggNOG
Pig100622432CBX3chromobox 39823OMA, EggNOG
Opossum100010415CBX3chromobox 313616Inparanoid, OMA, EggNOG
Platypus100079167CBX3chromobox 39258Inparanoid, OMA, EggNOG
Chicken395355CBX3chromobox 39031CGNC:8386Inparanoid, OMA
Anole lizard100561447cbx3chromobox 328377Inparanoid, OMA, EggNOG
Xenopus100038121cbx3chromobox 38364XB-GENE-492315Inparanoid, OMA, EggNOG
Zebrafish751689cbx3achromobox homolog 3a (HP1 gamma homolog, Drosophila)7955ZDB-GENE-030131-1158Inparanoid, OMA
C. elegans181450hpl-1HP1 Like (heterochromatin protein)6239OMA, EggNOG

Protein Classes

DTO Classes
protein    /    Epigenetic regulator    /    Reader    /    Methyl-lysine/arginine binding protein    /    Chromodomain    /    Chromobox protein homolog 3

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.