224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Transcription factor BTF3 |
|---|
Gene and Protein Information
| Gene ID | 689 |
|---|---|
| Uniprot Accession IDs | P20290 A8K510 Q13893 Q76M56 |
| Ensembl ID | ENSP00000369965 |
| Symbol | NACB NACB BTF3a BTF3b BETA-NAC |
| Family | Belongs to the NAC-beta family. |
| Sequence | MRRTGAPAQADSRGRGRARGGCPGGEATLSQPPPRGGTRGQEPQMKETIMNQEKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQFSLKKLGVNNISGIEEVNMFTNQGTVIHFNNPKVQASLAANTFTITGHAETKQLTEMLPSILNQLGADSLTSLRRLAEALPKQSVDGKAPLATGEDDDDEVPDLVENFDEASKNEAN |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 461812 | BTF3 | basic transcription factor 3 | 9598 | VGNC:3911 | OMA, EggNOG |
| Macaque | 703339 | BTF3 | basic transcription factor 3 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 218490 | Btf3 | basic transcription factor 3 | 10090 | MGI:1202875 | Inparanoid, OMA, EggNOG |
| Rat | 294680 | Btf3 | basic transcription factor 3 | 10116 | RGD:1308095 | OMA, EggNOG |
| Dog | 608628 | BTF3 | basic transcription factor 3 | 9615 | VGNC:52111 | Inparanoid, OMA |
| Horse | 100065663 | BTF3 | basic transcription factor 3 | 9796 | VGNC:15917 | Inparanoid, OMA, EggNOG |
| Cow | 281031 | BTF3 | basic transcription factor 3 | 9913 | VGNC:26595 | Inparanoid, OMA, EggNOG |
| Pig | 100514824 | BTF3 | basic transcription factor 3 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100011346 | BTF3 | basic transcription factor 3 | 13616 | OMA, EggNOG | |
| Platypus | 100082516 | BTF3 | basic transcription factor 3 | 9258 | Inparanoid, OMA, EggNOG | |
| Chicken | 426154 | BTF3 | basic transcription factor 3 | 9031 | CGNC:10153 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100556760 | btf3 | basic transcription factor 3 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 549451 | btf3 | basic transcription factor 3 | 8364 | XB-GENE-985803 | Inparanoid, OMA, EggNOG |
| Zebrafish | 556625 | btf3 | basic transcription factor 3 | 7955 | ZDB-GENE-030131-8731 | Inparanoid, OMA, EggNOG |
| C. elegans | 174090 | icd-1 | Transcription factor BTF3 homolog | 6239 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.