🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

C1QB

DescriptionComplement C1q subcomponent subunit B

Gene and Protein Information

Gene ID713
Uniprot Accession IDs P02746 Q5T959 Q96H17
Ensembl ID ENSP00000313967
Sequence
MMMKIPWGSIPVLMLLLLLGLIDISQAQLSCTGPPAIPGIPGIPGTPGPDGQPGTPGIKGEKGLPGLAGDHGEFGEKGDPGIPGNPGKVGPKGPMGPKGGPGAPGAPGPKGESGDYKATQKIAFSATRTINVPLRRDQTIRFDHVITNMNNNYEPRSGKFTCKVPGLYYFTYHASSRGNLCVNLMRGRERAQKVVTFCDYAYNTFQVTTGGMVLKLEQGENVFLQATDKNSLLGMEGANSIFSGFLLFPDMEA
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Mouse12260C1qbcomplement component 1, q subcomponent, beta polypeptide10090MGI:88224Inparanoid, OMA, EggNOG
Rat29687C1qbcomplement C1q B chain10116RGD:2229Inparanoid, OMA, EggNOG
Dog487381C1QBcomplement C1q B chain9615VGNC:38577Inparanoid, OMA, EggNOG
Horse100071667C1QBcomplement C1q B chain9796VGNC:15937Inparanoid, OMA, EggNOG
Cow617435C1QBcomplement C1q B chain9913VGNC:26617Inparanoid, OMA, EggNOG
Opossum100029312C1QBcomplement C1q B chain13616Inparanoid, OMA, EggNOG
Chicken428197C1QBcomplement C1q B chain9031CGNC:3540Inparanoid, OMA, EggNOG
Xenopusc1qbcomplement C1q B chain [Source:Xenbase;Acc:XB-GENE-6251287]8364OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.