🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

CTSS

DescriptionCathepsin S

Gene and Protein Information

Gene ID1520
Uniprot Accession IDs P25774 B4DWC9 D3DV05 Q5T5I0 Q6FHS5 Q9BUG3
Ensembl ID ENSP00000357981
FamilyBelongs to the peptidase C1 family.
Sequence
MKRLVCVLLVCSSAVAQLHKDPTLDHHWHLWKKTYGKQYKEKNEEAVRRLIWEKNLKFVMLHNLEHSMGMHSYDLGMNHLGDMTSEEVMSLMSSLRVPSQWQRNITYKSNPNRILPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEI
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp457277CTSScathepsin S9598VGNC:516OMA, EggNOG
Macaque708080CTSScathepsin S9544OMA, EggNOG
Mouse13040Ctsscathepsin S10090MGI:107341Inparanoid, OMA, EggNOG
Rat50654Ctsscathepsin S10116RGD:621513Inparanoid, OMA
Dog403400CTSScathepsin S9615VGNC:39715Inparanoid, OMA, EggNOG
Horse100054948CTSScathepsin S9796VGNC:16955Inparanoid, OMA, EggNOG
Cow327711CTSScathepsin S9913VGNC:27818Inparanoid, OMA, EggNOG
Pig100153090CTSScathepsin S9823OMA, EggNOG
Opossum100017406CTSScathepsin S13616Inparanoid, OMA, EggNOG
PlatypusCTSScathepsin S [Source:HGNC Symbol;Acc:HGNC:2545]9258OMA, EggNOG
Chicken425657CTSScathepsin S9031CGNC:494Inparanoid, OMA, EggNOG
Anole lizard100560943ctsscathepsin S28377Inparanoid, OMA, EggNOG
Xenopus448203ctsscathepsin S8364XB-GENE-953011Inparanoid, OMA, EggNOG
Zebrafish337572ctss2.2cathepsin S, ortholog 2, tandem duplicate 27955ZDB-GENE-050626-55OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.