224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Cathepsin L2 |
|---|
Gene and Protein Information
| Gene ID | 1515 |
|---|---|
| Uniprot Accession IDs | O60911 O60233 Q2TB86 Q5T1U0 |
| Ensembl ID | ENSP00000445052 |
| Symbol | CATL2 CTSL2 CTSU CTSU CATL2 CTSL2 |
| Family | Belongs to the peptidase C1 family. |
| Sequence | MNLSLVLAAFCLGIASAVPKFDQNLDTKWYQWKATHRRLYGANEEGWRRAVWEKNMKMIELHNGEYSQGKHGFTMAMNAFGDMTNEEFRQMMGCFRNQKFRKGKVFREPLFLDLPKSVDWRKKGYVTPVKNQKQCGSCWAFSATGALEGQMFRKTGKLVSLSEQNLVDCSRPQGNQGCNGGFMARAFQYVKENGGLDSEESYPYVAVDEICKYRPENSVANDTGFTVVAPGKEKALMKAVATVGPISVAMDAGHSSFQFYKSGIYFEPDCSSKNLDHGVLVVGYGFEGANSNNSKYWLVKNSWGPEWGSNGYVKIAKDKNNHCGIATAASYPNV Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 107976728 | CTSV | cathepsin V | 9598 | VGNC:4667 | OMA, EggNOG |
| Macaque | 710850 | CTSV | cathepsin V | 9544 | OMA, EggNOG | |
| Mouse | 13039 | Ctsl | cathepsin L | 10090 | MGI:88564 | OMA, EggNOG |
| Horse | 100061234 | CTSV | cathepsin V | 9796 | OMA, EggNOG | |
| Cow | 281108 | CTSV | cathepsin V | 9913 | OMA, EggNOG | |
| Pig | 396926 | CTSV | cathepsin V | 9823 | Inparanoid, OMA, EggNOG | |
| Platypus | 100093369 | LOC100093369 | cathepsin L1-like | 9258 | OMA, EggNOG | |
| Chicken | 427466 | CTSV | cathepsin V | 9031 | CGNC:53096 | OMA, EggNOG |
| Anole lizard | 100561941 | ctsl | cathepsin L | 28377 | OMA, EggNOG | |
| Xenopus | 448179 | ctsv | cathepsin V | 8364 | XB-GENE-966214 | OMA, EggNOG |
| Zebrafish | 321453 | ctsla | cathepsin La | 7955 | ZDB-GENE-030131-106 | OMA, EggNOG |
| Fruitfly | 36546 | Cp1 | Cysteine proteinase-1 | 7227 | FBgn0013770 | Inparanoid, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.