224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Cyclin-H |
|---|
Gene and Protein Information
| Gene ID | 902 |
|---|---|
| Uniprot Accession IDs | P51946 Q53X72 Q8TBL9 |
| Ensembl ID | ENSP00000256897 |
| Symbol | CAK p34 p37 CycH |
| Family | Belongs to the cyclin family. Cyclin C subfamily. |
| Sequence | MYHNSSQKRHWTFSSEEQLARLRADANRKFRCKAVANGKVLPNDPVFLEPHEEMTLCKYYEKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNVSSPQFVGNLRESPLGQEKALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYPILENPEILRKTADDFLNRIALTDAYLLYTPSQIALTAILSSASRAGITMESYLSESLMLKENRTCLSQLLDIMKSMRNLVKKYEPPRSEEVAVLKQKLERCHSAELALNVITKKRKGYEDDDYVSKKSKHEEEEWTDDDLVESL Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 739351 | CCNH | cyclin H | 9598 | VGNC:11871 | Inparanoid, OMA, EggNOG |
| Macaque | 694224 | CCNH | cyclin H | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 66671 | Ccnh | cyclin H | 10090 | MGI:1913921 | Inparanoid, OMA, EggNOG |
| Rat | 84389 | Ccnh | cyclin H | 10116 | RGD:69419 | Inparanoid, OMA, EggNOG |
| Dog | 479156 | CCNH | cyclin H | 9615 | VGNC:38902 | Inparanoid, OMA, EggNOG |
| Horse | 100065185 | CCNH | cyclin H | 9796 | VGNC:16216 | Inparanoid, OMA, EggNOG |
| Cow | 615512 | CCNH | cyclin H | 9913 | Inparanoid, OMA | |
| Pig | 100310796 | CCNH | cyclin H | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100011386 | CCNH | cyclin H | 13616 | Inparanoid, OMA, EggNOG | |
| Platypus | CCNH | cyclin H [Source:HGNC Symbol;Acc:HGNC:1594] | 9258 | OMA, EggNOG | ||
| Chicken | 427328 | CCNH | cyclin H | 9031 | CGNC:11662 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100561616 | ccnh | cyclin H | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 549010 | ccnh | cyclin H | 8364 | XB-GENE-922561 | Inparanoid, OMA, EggNOG |
| Zebrafish | 541325 | ccnh | cyclin H | 7955 | ZDB-GENE-050320-13 | Inparanoid, OMA, EggNOG |
| C. elegans | 190078 | cyh-1 | CYclin H | 6239 | Inparanoid, OMA, EggNOG | |
| Fruitfly | 40429 | CycH | Cyclin H | 7227 | FBgn0022936 | Inparanoid, EggNOG |
| S.cerevisiae | 856136 | CCL1 | TFIIH complex kinase subunit CCL1 | 4932 | S000006229 | Inparanoid, OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / nucleic acid binding / mRNA processing factor / Cyclin-H
protein / nucleic acid binding / kinase activator / Cyclin-H
protein / nucleic acid binding / transcription cofactor / Cyclin-H
protein / nucleic acid binding / mRNA processing factor / Cyclin-H
protein / nucleic acid binding / kinase activator / Cyclin-H
protein / nucleic acid binding / transcription cofactor / Cyclin-H
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.