🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

CDX2

DescriptionHomeobox protein CDX-2

Gene and Protein Information

Gene ID1045
Uniprot Accession IDs Q99626 O00503 Q5VTU7 Q969L8 Q9UD92
Ensembl ID ENSP00000370408
Symbol CDX3 CDX3 CDX-3 CDX2/AS
FamilyBelongs to the Caudal homeobox family.
Sequence
MYVSYLLDKDVSMYPSSVRHSGGLNLAPQNFVSPPQYPDYGGYHVAAAAAAAANLDSAQSPGPSWPAAYGAPLREDWNGYAPGGAAAAANAVAHGLNGGSPAAAMGYSSPADYHPHHHPHHHPHHPAAAPSCASGLLQTLNPGPPGPAATAAAEQLSPGGQRRNLCEWMRKPAQQSLGSQVKTRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKAELAATLGLSERQVKIWFQNRRAKERKINKKKLQQQQQQQPPQPPPPPPQPPQPQPGPLRSVPEPLSPVSSLQASVPGSVPGVLGPTGGVLNPTVTQ
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp467350CDX2caudal type homeobox 29598VGNC:13071Inparanoid, OMA
Mouse12591Cdx2caudal type homeobox 210090MGI:88361Inparanoid, OMA, EggNOG
Rat66019Cdx2caudal type homeo box 210116RGD:621234Inparanoid, OMA, EggNOG
Dog486028CDX2caudal type homeobox 29615VGNC:39085Inparanoid, OMA, EggNOG
Horse100051406CDX2caudal type homeobox 29796VGNC:51937Inparanoid, OMA
Pig100127132CDX2caudal type homeobox 29823Inparanoid, OMA, EggNOG
Opossum100019885CDX2caudal type homeobox 213616Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    nucleic acid binding    /    DNA binding protein    /    Homeobox protein CDX-2
protein    /    nucleic acid binding    /    homeodomain transcription factor    /    Homeobox protein CDX-2
DTO Classes
protein    /    Transcription factor    /    Helix-turn-helix transcription factor    /    Homeodomain transcription factor    /    Homeobox protein CDX-2

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.