224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Carbonyl reductase [NADPH] 1 |
|---|
Gene and Protein Information
| Gene ID | 873 |
|---|---|
| Uniprot Accession IDs | P16152 B2RBZ7 B4DFK7 Q3LHW8 |
| Ensembl ID | ENSP00000290349 |
| Symbol | CBR CRN SDR21C1 CBR hCBR1 SDR21C1 |
| Family | Belongs to the short-chain dehydrogenases/reductases (SDR) family. |
| Sequence | MSSGIHVALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGLSPRFHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPSSAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 473983 | CBR1 | carbonyl reductase 1 | 9598 | VGNC:14651 | OMA, EggNOG |
| Macaque | 699655 | LOC699655 | carbonyl reductase [NADPH] 1 | 9544 | OMA, EggNOG | |
| Mouse | 12408 | Cbr1 | carbonyl reductase 1 | 10090 | MGI:88284 | Inparanoid, OMA, EggNOG |
| Rat | 102556347 | LOC102556347 | carbonyl reductase [NADPH] 1-like | 10116 | RGD:7631561 | OMA, EggNOG |
| Dog | 610164 | LOC610164 | carbonyl reductase [NADPH] 1 | 9615 | OMA, EggNOG | |
| Horse | 100061787 | LOC100061787 | carbonyl reductase [NADPH] 1 | 9796 | Inparanoid, OMA, EggNOG | |
| Cow | 515946 | CBR1 | carbonyl reductase 1 | 9913 | OMA, EggNOG | |
| Pig | - | carbonyl reductase [Source:RefSeq peptide;Acc:NP_001302675] | 9823 | OMA, EggNOG | ||
| Platypus | 100081857 | LOC100081857 | carbonyl reductase [NADPH] 1 | 9258 | OMA, EggNOG | |
| Chicken | 418512 | CBR1 | carbonyl reductase 1 | 9031 | CGNC:50782 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.