🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA Structure
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

CCNE2

DescriptionG1/S-specific cyclin-E2

Gene and Protein Information

Gene ID9134
Uniprot Accession IDs O96020 O95439
Ensembl ID ENSP00000429089
Symbol CYCE2
FamilyBelongs to the cyclin family. Cyclin E subfamily.
Sequence
MSRRSSRLQAKQQPQPSQTESPQEAQIIQAKKRKTTQDVKKRREEVTKKHQYEIRNCWPPVLSGGISPCIIIETPHKEIGTSDFSRFTNYRFKNLFINPSPLPDLSWGCSKEVWLNMLKKESRYVHDKHFEVLHSDLEPQMRSILLDWLLEVCEVYTLHRETFYLAQDFFDRFMLTQKDINKNMLQLIGITSLFIASKLEEIYAPKLQEFAYVTDGACSEEDILRMELIILKALKWELCPVTIISWLNLFLQVDALKDAPKVLLPQYSQETFIQIAQLLDLCILAIDSLEFQYRILTAAALCHFTSIEVVKKASGLEWDSISECVDWMVPFVNVVKSTSPVKLKTFKKIPMEDRHNIQTHTNYLAMLEEVNYINTFRKGGQLSPVCNGGIMTPPKSTEKPPGKH
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp464292CCNE2cyclin E29598VGNC:905OMA, EggNOG
Macaque700382CCNE2cyclin E29544Inparanoid, OMA
Mouse12448Ccne2cyclin E210090MGI:1329034Inparanoid, OMA, EggNOG
Rat362485Ccne2cyclin E210116RGD:1307783Inparanoid, OMA, EggNOG
Dog487057CCNE2cyclin E29615VGNC:54109Inparanoid, OMA, EggNOG
Horse100055302CCNE2cyclin E29796VGNC:16212Inparanoid, OMA, EggNOG
Cow538436CCNE2cyclin E29913VGNC:26967Inparanoid, OMA, EggNOG
Pig100512048CCNE2cyclin E29823Inparanoid, OMA, EggNOG
Opossum100022654CCNE2cyclin E213616OMA, EggNOG
Platypus100075784CCNE2cyclin E29258Inparanoid, OMA, EggNOG
Anole lizard100563792ccne2cyclin E228377Inparanoid, OMA
Xenopus549021ccne2cyclin E28364XB-GENE-923043Inparanoid, OMA
Zebrafish415165ccne2cyclin E27955ZDB-GENE-030131-9689Inparanoid, OMA
C. elegans172399cye-1G1/S-specific cyclin-E6239Inparanoid, EggNOG

Protein Classes

PANTHER Classes
protein    /    enzyme modulator    /    kinase activator    /    G1/S-specific cyclin-E2
DTO Classes
protein    /    Enzyme modulator    /    Kinase modulator    /    Kinase activator    /    G1/S-specific cyclin-E2

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.