🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

CDC42

DescriptionCell division control protein 42 homolog

Gene and Protein Information

Gene ID998
Uniprot Accession IDs P60953 P21181 P25763 Q7L8R5 Q9UDI2
Ensembl ID ENSP00000383118
Symbol TKS G25K CDC42Hs
FamilyBelongs to the small GTPase superfamily. Rho family. CDC42 subfamily.
Sequence
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVLL
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Macaque707637CDC42cell division cycle 429544OMA, EggNOG
Mouse12540Cdc42cell division cycle 4210090MGI:106211Inparanoid, OMA, EggNOG
Rat64465Cdc42cell division cycle 4210116RGD:71043Inparanoid, OMA, EggNOG
Dog403934CDC42cell division cycle 429615Inparanoid, OMA, EggNOG
Horse100058188CDC42cell division cycle 429796Inparanoid, OMA, EggNOG
Pig780428CDC42cell division cycle 429823Inparanoid, OMA, EggNOG
Opossum100023099CDC42cell division cycle 4213616Inparanoid, OMA, EggNOG
Chicken395917CDC42cell division cycle 429031CGNC:3561Inparanoid, OMA
Xenopus493389cdc42cell division cycle 428364XB-GENE-967585Inparanoid, OMA, EggNOG
Zebrafish336839cdc42cell division cycle 427955ZDB-GENE-030131-8783Inparanoid, OMA
Fruitfly32981Cdc42CG12530 gene product from transcript CG12530-RC7227FBgn0010341Inparanoid, EggNOG
S.cerevisiae850930CDC42Rho family GTPase CDC424932S000004219Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    enzyme modulator    /    small GTPase    /    Cell division control protein 42 homolog
DTO Classes
protein    /    Enzyme modulator    /    G-protein    /    Small GTPase    /    Cell division control protein 42 homolog

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.