🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

CDKN2C

DescriptionCyclin-dependent kinase 4 inhibitor C

Gene and Protein Information

Gene ID1031
Uniprot Accession IDs P42773 Q8TB83
Ensembl ID ENSP00000262662
Symbol CDKN6 p18 INK4C p18-INK4C
FamilyBelongs to the CDKN2 cyclin-dependent kinase inhibitor family.
Sequence
MAEPWGNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRGANPDLKDRTGFAVIHDAARAGFLDTLQTLLEFQADVNIEDNEGNLPLHLAAKEGHLRVVEFLVKHTASNVGHRNHKGDTACDLARLYGRNEVVSLMQANGAGGATNLQ
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp469319CDKN2Ccyclin dependent kinase inhibitor 2C9598VGNC:8152OMA, EggNOG
Macaque711877CDKN2Ccyclin dependent kinase inhibitor 2C9544Inparanoid, OMA, EggNOG
Mouse12580Cdkn2ccyclin dependent kinase inhibitor 2C10090MGI:105388Inparanoid, OMA, EggNOG
Rat54238Cdkn2ccyclin-dependent kinase inhibitor 2C10116RGD:2325Inparanoid, OMA, EggNOG
Dog475359CDKN2Ccyclin dependent kinase inhibitor 2C9615VGNC:39072Inparanoid, OMA, EggNOG
Horse100051195CDKN2Ccyclin dependent kinase inhibitor 2C9796VGNC:16366Inparanoid, OMA, EggNOG
Cow505691CDKN2Ccyclin dependent kinase inhibitor 2C9913VGNC:27146Inparanoid, OMA, EggNOG
Pig100515210CDKN2Ccyclin dependent kinase inhibitor 2C9823OMA, EggNOG
Opossum100020812CDKN2Ccyclin dependent kinase inhibitor 2C13616Inparanoid, OMA, EggNOG
Chicken429104CDKN2Ccyclin dependent kinase inhibitor 2C9031CGNC:8002Inparanoid, OMA, EggNOG
Anole lizard100556777cdkn2ccyclin dependent kinase inhibitor 2C28377Inparanoid, OMA, EggNOG
Xenopus100144705cdkn2ccyclin-dependent kinase inhibitor 2C8364XB-GENE-479532Inparanoid, OMA, EggNOG
Zebrafish555797cdkn2ccyclin-dependent kinase inhibitor 2C (p18, inhibits CDK4)7955ZDB-GENE-081104-145Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.