🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

DIABLO

DescriptionDiablo homolog, mitochondrial

Gene and Protein Information

Gene ID56616
Uniprot Accession IDs Q9NR28 B2RDQ0 Q6W3F3 Q96LV0 Q9BT11 Q9HAV6
Ensembl ID ENSP00000398495
Symbol SMAC SMAC DFNA64
Sequence
MAALKSWLSRSVTSFFRYRQCLCVPVVANFKKRCFSELIRPWHKTVTIGFGVTLCAVPIAQKSEPHSLSSEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEGEERAESEQEAYLRED
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Mouse66593Diablodiablo, IAP-binding mitochondrial protein10090MGI:1913843Inparanoid, OMA
Rat100360940LOC100360940diablo-like10116RGD:2321120Inparanoid, OMA
Dog477463DIABLOdiablo IAP-binding mitochondrial protein9615VGNC:39954Inparanoid, OMA
Horse100058709DIABLOdiablo IAP-binding mitochondrial protein9796VGNC:17182Inparanoid, OMA
Cow493999DIABLOdiablo IAP-binding mitochondrial protein9913VGNC:28061Inparanoid, OMA
Pig100155744DIABLOdiablo IAP-binding mitochondrial protein9823Inparanoid, OMA
Opossum100022080DIABLOdiablo IAP-binding mitochondrial protein13616Inparanoid, OMA
Chicken416860DIABLOdiablo IAP-binding mitochondrial protein9031CGNC:3247Inparanoid, OMA
Anole lizard100566579diablodiablo IAP-binding mitochondrial protein28377Inparanoid, OMA
Xenopus549035diablodiablo, IAP-binding mitochondrial protein8364XB-GENE-5915561Inparanoid, OMA
Zebrafish570425diablobdiablo, IAP-binding mitochondrial protein b7955ZDB-GENE-070112-202Inparanoid, OMA

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.