🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

DNAJC15

DescriptionDnaJ homolog subfamily C member 15

Gene and Protein Information

Gene ID29103
Uniprot Accession IDs Q9Y5T4 B2R4L0 Q5T219 Q6X963
Ensembl ID ENSP00000368523
Symbol DNAJD1 MCJ HSD18 DNAJD1
Sequence
MAARGVIAPVGESLRYAEYLQPSAKRPDADVDQQRLVRSLIAVGLGVAALAFAGRYAFRIWKPLEQVITETAKKISTPSFSSYYKGGFEQKMSRREAGLILGVSPSAGKAKIRTAHRRVMILNHPDKGGSPYVAAKINEAKDLLETTTKH
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Macaque700339DNAJC15DnaJ heat shock protein family (Hsp40) member C159544Inparanoid, OMA, EggNOG
Mouse66148Dnajc15DnaJ heat shock protein family (Hsp40) member C1510090MGI:1913398Inparanoid, OMA, EggNOG
Rat290370Dnajc15DnaJ heat shock protein family (Hsp40) member C1510116RGD:1307154Inparanoid, OMA, EggNOG
Dog476930DNAJC15DnaJ heat shock protein family (Hsp40) member C159615Inparanoid, OMA, EggNOG
HorseDNAJC15DnaJ heat shock protein family (Hsp40) member C15 [Source:HGNC Symbol;Acc:HGNC:20325]9796OMA, EggNOG
Cow618047DNAJC15DnaJ heat shock protein family (Hsp40) member C159913VGNC:53812Inparanoid, OMA, EggNOG
Opossum100015173DNAJC15DnaJ heat shock protein family (Hsp40) member C1513616Inparanoid, OMA, EggNOG
Chicken418838DNAJC15DnaJ heat shock protein family (Hsp40) member C159031CGNC:12733Inparanoid, OMA, EggNOG
Anole lizard100568099dnajc15DnaJ heat shock protein family (Hsp40) member C1528377Inparanoid, OMA, EggNOG
Xenopus448735dnajc15DnaJ heat shock protein family (Hsp40) member C158364XB-GENE-5716026Inparanoid, OMA, EggNOG
Zebrafish445082dnajc15DnaJ (Hsp40) homolog, subfamily C, member 157955ZDB-GENE-040801-216Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.