DNAJC15

DescriptionDnaJ homolog subfamily C member 15

Gene and Protein Information

Gene ID29103
Uniprot Accession IDs Q9Y5T4 B2R4L0 Q5T219 Q6X963
Ensembl ID ENSP00000368523
Symbol DNAJD1 MCJ HSD18 DNAJD1
Sequence
MAARGVIAPVGESLRYAEYLQPSAKRPDADVDQQRLVRSLIAVGLGVAALAFAGRYAFRIWKPLEQVITETAKKISTPSFSSYYKGGFEQKMSRREAGLILGVSPSAGKAKIRTAHRRVMILNHPDKGGSPYVAAKINEAKDLLETTTKH
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Macaque700339DNAJC15DnaJ heat shock protein family (Hsp40) member C159544Inparanoid, OMA, EggNOG
Mouse66148Dnajc15DnaJ heat shock protein family (Hsp40) member C1510090MGI:1913398Inparanoid, OMA, EggNOG
Rat290370Dnajc15DnaJ heat shock protein family (Hsp40) member C1510116RGD:1307154Inparanoid, OMA, EggNOG
Dog476930DNAJC15DnaJ heat shock protein family (Hsp40) member C159615Inparanoid, OMA, EggNOG
HorseDNAJC15DnaJ heat shock protein family (Hsp40) member C15 [Source:HGNC Symbol;Acc:HGNC:20325]9796OMA, EggNOG
Cow618047DNAJC15DnaJ heat shock protein family (Hsp40) member C159913VGNC:53812Inparanoid, OMA, EggNOG
Opossum100015173DNAJC15DnaJ heat shock protein family (Hsp40) member C1513616Inparanoid, OMA, EggNOG
Chicken418838DNAJC15DnaJ heat shock protein family (Hsp40) member C159031CGNC:12733Inparanoid, OMA, EggNOG
Anole lizard100568099dnajc15DnaJ heat shock protein family (Hsp40) member C1528377Inparanoid, OMA, EggNOG
Xenopus448735dnajc15DnaJ heat shock protein family (Hsp40) member C158364XB-GENE-5716026Inparanoid, OMA, EggNOG
Zebrafish445082dnajc15DnaJ (Hsp40) homolog, subfamily C, member 157955ZDB-GENE-040801-216Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.