224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Gap junction beta-7 protein |
|---|
Gene and Protein Information
| Gene ID | 375519 |
|---|---|
| Uniprot Accession IDs | Q6PEY0 B3KXL0 Q96KP0 |
| Ensembl ID | ENSP00000435355 |
| Symbol | CX25 CX25 bA136M9.1 connexin25 |
| Family | Belongs to the connexin family. Beta-type (group I) subfamily. |
| Sequence | MSWMFLRDLLSGVNKYSTGTGWIWLAVVFVFRLLVYMVAAEHVWKDEQKEFECNSRQPGCKNVCFDDFFPISQVRLWALQLIMVSTPSLLVVLHVAYHEGREKRHRKKLYVSPGTMDGGLWYAYLISLIVKTGFEIGFLVLFYKLYDGFSVPYLIKCDLKPCPNTVDCFISKPTEKTIFILFLVITSCLCIVLNFIELSFLVLKCFIKCCLQKYLKKPQVLSV |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Horse | 100070584 | GJB7 | gap junction protein beta 7 | 9796 | VGNC:51032 | Inparanoid, OMA |
| Opossum | 100025224 | GJB7 | gap junction protein beta 7 | 13616 | Inparanoid, OMA | |
| Xenopus | 100488401 | gjb7 | gap junction protein beta 7 | 8364 | XB-GENE-965093 | Inparanoid, OMA |
| Zebrafish | 566668 | cx28.8 | connexin 28.8 | 7955 | ZDB-GENE-050616-1 | Inparanoid, OMA |
Protein Classes
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.