224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | DCN1-like protein 1 |
|---|
Gene and Protein Information
| Gene ID | 54165 |
|---|---|
| Uniprot Accession IDs | Q96GG9 B2RB37 Q7L3G9 Q8TEX7 Q9H6M1 Q9HCT3 |
| Ensembl ID | ENSP00000292782 |
| Symbol | DCN1 DCUN1L1 RP42 SCCRO RP42 SCRO Tes3 DCNL1 SCCRO DCUN1L1 |
| Sequence | MNKLKSSQKDKVRQFMIFTQSSEKTAVSCLSQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYNRYKDPQDENKIGIDGIQQFCDDLALDPASISVLIIAWKFRAATQCEFSKQEFMDGMTELGCDSIEKLKAQIPKMEQELKEPGRFKDFYQFTFNFAKNPGQKGLDLEMAIAYWNLVLNGRFKFLDLWNKFLLEHHKRSIPKDTWNLLLDFSTMIADDMSNYDEEGAWPVLIDDFVEFARPQIAGTKSTTV |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 460870 | DCUN1D1 | defective in cullin neddylation 1 domain containing 1 | 9598 | VGNC:11380 | OMA, EggNOG |
| Macaque | 708357 | DCUN1D1 | defective in cullin neddylation 1 domain containing 1 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 114893 | Dcun1d1 | DCN1, defective in cullin neddylation 1, domain containing 1 (S. cerevisiae) | 10090 | MGI:2150386 | Inparanoid, OMA, EggNOG |
| Dog | 606979 | DCUN1D1 | defective in cullin neddylation 1 domain containing 1 | 9615 | VGNC:39822 | Inparanoid, OMA |
| Horse | 100066587 | DCUN1D1 | defective in cullin neddylation 1 domain containing 1 | 9796 | VGNC:17062 | Inparanoid, OMA |
| Cow | 539869 | DCUN1D1 | defective in cullin neddylation 1 domain containing 1 | 9913 | VGNC:27935 | Inparanoid, OMA, EggNOG |
| Pig | 100624319 | DCUN1D1 | defective in cullin neddylation 1 domain containing 1 | 9823 | OMA, EggNOG | |
| Chicken | 424963 | DCUN1D1 | defective in cullin neddylation 1 domain containing 1 | 9031 | CGNC:6684 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100562740 | dcun1d1 | defective in cullin neddylation 1 domain containing 1 | 28377 | Inparanoid, OMA | |
| Zebrafish | 327232 | dcun1d1 | DCN1, defective in cullin neddylation 1, domain containing 1 (S. cerevisiae) | 7955 | ZDB-GENE-030131-5443 | Inparanoid, OMA |
| S.cerevisiae | 850819 | DCN1 | NEDD8 ligase DCN1 | 4932 | S000004118 | OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.