🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

HSD11B1

DescriptionCorticosteroid 11-beta-dehydrogenase isozyme 1

Gene and Protein Information

Gene ID3290
Uniprot Accession IDs P28845 B2R9Z1 D3DT89
Ensembl ID ENSP00000355995
Symbol HSD11 HSD11L SDR26C1 HDL 11-DH HSD11 HSD11B HSD11L CORTRD2 SDR26C1 11-beta-HSD1
FamilyBelongs to the short-chain dehydrogenases/reductases (SDR) family.
Sequence
MAFMKKYLLPILGLFMAYYYYSANEEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPCRKILEFLYSTSYNMDRFINK
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp457698HSD11B1hydroxysteroid 11-beta dehydrogenase 19598VGNC:11453OMA, EggNOG
Mouse15483Hsd11b1hydroxysteroid 11-beta dehydrogenase 110090MGI:103562Inparanoid, OMA, EggNOG
Rat25116Hsd11b1hydroxysteroid 11-beta dehydrogenase 110116RGD:2834Inparanoid, OMA
Dog449023HSD11B1hydroxysteroid 11-beta dehydrogenase 19615VGNC:41797Inparanoid, OMA, EggNOG
Horse100056429HSD11B1hydroxysteroid 11-beta dehydrogenase 19796VGNC:18880Inparanoid, OMA, EggNOG
Cow282589HSD11B1hydroxysteroid 11-beta dehydrogenase 19913VGNC:29965Inparanoid, OMA, EggNOG
Pig397480HSD11B1hydroxysteroid 11-beta dehydrogenase 19823Inparanoid, OMA, EggNOG
Platypus100079059HSD11B1hydroxysteroid 11-beta dehydrogenase 19258Inparanoid, OMA, EggNOG
Anole lizard100555338hsd11b1hydroxysteroid 11-beta dehydrogenase 128377Inparanoid, OMA, EggNOG
Xenopus100489345hsd11b1hydroxysteroid (11-beta) dehydrogenase 18364XB-GENE-960491Inparanoid, OMA

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.