🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA Structure
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

DLX3

DescriptionHomeobox protein DLX-3

Gene and Protein Information

Gene ID1747
Uniprot Accession IDs O60479 B3KQL6
Ensembl ID ENSP00000389870
Symbol AI4 TDO
FamilyBelongs to the distal-less homeobox family.
Sequence
MSGSFDRKLSSILTDISSSLSCHAGSKDSPTLPESSVTDLGYYSAPQHDYYSGQPYGQTVNPYTYHHQFNLNGLAGTGAYSPKSEYTYGASYRQYGAYREQPLPAQDPVSVKEEPEAEVRMVNGKPKKVRKPRTIYSSYQLAALQRRFQKAQYLALPERAELAAQLGLTQTQVKIWFQNRRSKFKKLYKNGEVPLEHSPNNSDSMACNSPPSPALWDTSSHSTPAPARSQLPPPLPYSASPSYLDDPTNSWYHAQNLSGPHLQQQPPQPATLHHASPGPPPNPGAVY
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp455110DLX3distal-less homeobox 39598VGNC:9259OMA, EggNOG
Macaque700831DLX3distal-less homeobox 39544Inparanoid, OMA, EggNOG
Mouse13393Dlx3distal-less homeobox 310090MGI:94903Inparanoid, OMA, EggNOG
Rat287638Dlx3distal-less homeobox 310116RGD:1304875Inparanoid, OMA, EggNOG
Dog491073DLX3distal-less homeobox 39615VGNC:39991Inparanoid, OMA, EggNOG
Horse100146218DLX3distal-less homeobox 39796VGNC:17221Inparanoid, OMA, EggNOG
Cow784366DLX3distal-less homeobox 39913Inparanoid, EggNOG
Pig100516335DLX3distal-less homeobox 39823OMA, EggNOG
Opossum100019196DLX3distal-less homeobox 313616Inparanoid, OMA, EggNOG
Anole lizard100564927dlx3distal-less homeobox 328377Inparanoid, OMA, EggNOG
Zebrafish30585dlx3bdistal-less homeobox 3b7955ZDB-GENE-980526-280Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    nucleic acid binding    /    DNA binding protein    /    Homeobox protein DLX-3
protein    /    nucleic acid binding    /    homeodomain transcription factor    /    Homeobox protein DLX-3
DTO Classes
protein    /    Transcription factor    /    Helix-turn-helix transcription factor    /    Homeodomain transcription factor    /    Homeobox protein DLX-3

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.