224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 |
|---|
Gene and Protein Information
| Gene ID | 2783 |
|---|---|
| Uniprot Accession IDs | P62879 B3KPU1 P11016 P54312 |
| Ensembl ID | ENSP00000305260 |
| Family | Belongs to the WD repeat G protein beta family. |
| Sequence | MSELEQLRQEAEQLRNQIRDARKACGDSTLTQITAGLDPVGRIQMRTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNICSIYSLKTREGNVRVSRELPGHTGYLSCCRFLDDNQIITSSGDTTCALWDIETGQQTVGFAGHSGDVMSLSLAPDGRTFVSGACDASIKLWDVRDSMCRQTFIGHESDINAVAFFPNGYAFTTGSDDATCRLFDLRADQELLMYSHDNIICGITSVAFSRSGRLLLAGYDDFNCNIWDAMKGDRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 739897 | GNB2 | G protein subunit beta 2 | 9598 | VGNC:8684 | OMA, EggNOG |
| Mouse | 14693 | Gnb2 | guanine nucleotide binding protein (G protein), beta 2 | 10090 | MGI:95784 | Inparanoid, OMA |
| Rat | 81667 | Gnb2 | G protein subunit beta 2 | 10116 | RGD:69319 | Inparanoid, OMA |
| Horse | 100067486 | GNB2 | G protein subunit beta 2 | 9796 | VGNC:18425 | Inparanoid, OMA |
| Cow | 281202 | GNB2 | G protein subunit beta 2 | 9913 | VGNC:29459 | Inparanoid, OMA |
| Opossum | 100017392 | GNB2 | G protein subunit beta 2 | 13616 | Inparanoid, OMA | |
| Zebrafish | 541370 | gnb2 | guanine nucleotide binding protein (G protein), beta polypeptide 2 | 7955 | ZDB-GENE-050320-65 | Inparanoid, OMA |
| C. elegans | 174803 | gpb-1 | G Protein, Beta subunit | 6239 | Inparanoid, OMA, EggNOG | |
| Fruitfly | 32544 | Gbeta13F | G protein beta-subunit 13F | 7227 | FBgn0001105 | Inparanoid, EggNOG |
| S.cerevisiae | 854387 | STE4 | G protein subunit beta | 4932 | S000005738 | OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / enzyme modulator / heterotrimeric G-protein / Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2
protein / enzyme modulator / hydrolase / Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2
protein / enzyme modulator / heterotrimeric G-protein / Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2
protein / enzyme modulator / hydrolase / Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.