🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

COX6C

DescriptionCytochrome c oxidase subunit 6C

Gene and Protein Information

Gene ID1345
Uniprot Accession IDs P09669 B2R4D7
Ensembl ID ENSP00000428895
FamilyBelongs to the cytochrome c oxidase subunit 6c family.
Sequence
MAPEVLPKPRMRGLLARRLRNHMAVAFVLSLGVAALYKFRVADQRKKAYADFYRNYDVMKDFEEMRKAGIFQSVK
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp741071COX6Ccytochrome c oxidase subunit 6C9598VGNC:903OMA, EggNOG
Macaque100428417COX6Ccytochrome c oxidase subunit 6C9544Inparanoid, OMA, EggNOG
Mouse12864Cox6ccytochrome c oxidase subunit VIc10090MGI:104614Inparanoid, OMA, EggNOG
Rat54322Cox6ccytochrome c oxidase subunit 6C10116RGD:620616OMA, EggNOG
Rat286962Cox6c-ps1cytochrome c oxidase subunit VIc, pseudogene10116RGD:735056Inparanoid, OMA
Cow614700MGC148714cytochrome c oxidase subunit 6C9913Inparanoid, EggNOG
Pig100037989COX6CCOX6C protein9823Inparanoid, OMA, EggNOG
Opossum100030489LOC100030489cytochrome c oxidase subunit 6C-213616OMA, EggNOG
Xenopus496600cox6ccytochrome c oxidase subunit VIc8364XB-GENE-1001882Inparanoid, OMA, EggNOG
Zebrafish494577cox6ccytochrome c oxidase subunit VIc7955ZDB-GENE-040724-95Inparanoid, OMA, EggNOG
Fruitfly46040cypecyclope7227FBgn0015031Inparanoid, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.