224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Chorionic somatomammotropin hormone 2 |
|---|
Gene and Protein Information
| Gene ID | 1443 |
|---|---|
| Uniprot Accession IDs | P0DML3 P01243 Q0VDB1 Q14407 Choriomammotropin |
| Ensembl ID | ENSP00000376623 |
| Symbol | PL CSB CS-2 GHB1 hCS-B |
| Family | Belongs to the somatotropin/prolactin family. |
| Sequence | MAAGSRTSLLLAFALLCLPWLQEAGAVQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEETYIPKDQKYSFLHDSQTSFCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLRSMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTNSHNHDALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGF |
Protein Classes
PANTHER Classes
protein / signaling molecule / peptide hormone / Chorionic somatomammotropin hormone 2
protein / signaling molecule / growth factor / Chorionic somatomammotropin hormone 2
protein / signaling molecule / peptide hormone / Chorionic somatomammotropin hormone 2
protein / signaling molecule / growth factor / Chorionic somatomammotropin hormone 2
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.