🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

CSF3

DescriptionGranulocyte colony-stimulating factor

Gene and Protein Information

Gene ID1440
Uniprot Accession IDs P09919 A8MXR7 G-CSF
Ensembl ID ENSP00000225474
Symbol C17orf33 GCSF GCSF CSF3OS C17orf33
FamilyBelongs to the IL-6 superfamily.
Sequence
MAGPATQSPMKLMALQLLLWHSALWTVQEATPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLVSECATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp454641CSF3colony stimulating factor 39598VGNC:9417OMA, EggNOG
Macaque698961CSF3colony stimulating factor 39544Inparanoid, OMA, EggNOG
Mouse12985Csf3colony stimulating factor 3 (granulocyte)10090MGI:1339751Inparanoid, OMA, EggNOG
Rat25610Csf3colony stimulating factor 310116RGD:2426Inparanoid, OMA, EggNOG
Dog608246CSF3colony stimulating factor 39615VGNC:39657Inparanoid, OMA, EggNOG
Horse100033922CSF3colony stimulating factor 39796VGNC:16898Inparanoid, OMA, EggNOG
Cow281096CSF3colony stimulating factor 39913VGNC:27757Inparanoid, OMA, EggNOG
Pig396839CSF3colony stimulating factor 39823Inparanoid, OMA
Opossum100016618CSF3colony stimulating factor 313616Inparanoid, OMA, EggNOG
Anole lizard103279240LOC103279240myelomonocytic growth factor28377OMA, EggNOG
Xenopus100497396csf3colony stimulating factor 38364XB-GENE-487092Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.