🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

CD3D

DescriptionT-cell surface glycoprotein CD3 delta chain

Gene and Protein Information

Gene ID915
Uniprot Accession IDs P04234 A8MVP6
Ensembl ID ENSP00000300692
Symbol T3D T3D IMD19 CD3-DELTA
Sequence
MEHSTFLSGLVLATLLSQVSPFKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVAGIIVTDVIATLLLALGVFCFAGHETGRLSGAADTQALLRNDQVYQPLRDRDDAQYSHLGGNWARNK
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp451584CD3DCD3d molecule9598VGNC:6481OMA, EggNOG
Macaque699582CD3DCD3d molecule9544Inparanoid, EggNOG
Mouse12500Cd3dCD3 antigen, delta polypeptide10090MGI:88331Inparanoid, OMA, EggNOG
Rat25710Cd3dCD3d molecule10116RGD:2304Inparanoid, OMA, EggNOG
Dog479419CD3DCD3d molecule9615VGNC:38954Inparanoid, OMA, EggNOG
Horse100062931CD3DCD3d molecule9796VGNC:16263Inparanoid, OMA, EggNOG
Cow281053CD3DCD3d molecule9913VGNC:27028Inparanoid, OMA, EggNOG
Pig396661CD3DCD3d molecule9823Inparanoid, OMA, EggNOG
Opossum100031472CD3DCD3d molecule13616Inparanoid, OMA, EggNOG
Chicken396518CD3DCD3d molecule9031CGNC:49849OMA, EggNOG
Xenopus100216101cd3gCD3g molecule8364XB-GENE-480422OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.