🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

CD3E

DescriptionT-cell surface glycoprotein CD3 epsilon chain

Gene and Protein Information

Gene ID916
Uniprot Accession IDs P07766 A8K997
Ensembl ID ENSP00000354566
Symbol T3E T3E TCRE IMD18
Sequence
MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp742330CD3ECD3e molecule9598VGNC:6482OMA, EggNOG
Macaque699467CD3ECD3e molecule9544Inparanoid, OMA, EggNOG
Mouse12501Cd3eCD3 antigen, epsilon polypeptide10090MGI:88332Inparanoid, OMA, EggNOG
Rat315609Cd3eCD3e molecule10116RGD:1309222Inparanoid, OMA, EggNOG
Dog442981CD3ECD3e molecule9615VGNC:38955Inparanoid, OMA, EggNOG
Horse100629532CD3ECD3e molecule9796VGNC:16264Inparanoid, OMA, EggNOG
Cow281054CD3ECD3e molecule9913VGNC:27029Inparanoid, OMA, EggNOG
Pig397455CD3ECD3e molecule9823Inparanoid, EggNOG
Opossum100031478CD3ECD3e molecule13616Inparanoid, OMA, EggNOG
Chicken396062CD3ECD3e molecule9031CGNC:5597Inparanoid, OMA, EggNOG
Xenopus100101735cd3eCD3e molecule8364XB-GENE-919749Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.