224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | CCAAT/enhancer-binding protein epsilon |
|---|
Gene and Protein Information
| Gene ID | 1053 |
|---|---|
| Uniprot Accession IDs | Q15744 Q15745 Q8IYI2 Q99803 C/EBP epsilon |
| Ensembl ID | ENSP00000206513 |
| Symbol | CRP1 C/EBP-epsilon |
| Family | Belongs to the bZIP family. C/EBP subfamily. |
| Sequence | MSHGTYYECEPRGGQQPLEFSGGRAGPGELGDMCEHEASIDLSAYIESGEEQLLSDLFAVKPAPEARGLKGPGTPAFPHYLPPDPRPFAYPPHTFGPDRKALGPGIYSSPGSYDPRAVAVKEEPRGPEGSRAASRGSYNPLQYQVAHCGQTAMHLPPTLAAPGQPLRVLKAPLATAAPPCSPLLKAPSPAGPLHKGKKAVNKDSLEYRLRRERNNIAVRKSRDKAKRRILETQQKVLEYMAENERLRSRVEQLTQELDTLRNLFRQIPEAANLIKGVGGCS |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 743538 | CEBPE | CCAAT enhancer binding protein epsilon | 9598 | VGNC:8195 | OMA, EggNOG |
| Macaque | 713442 | CEBPE | CCAAT/enhancer binding protein epsilon | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 110794 | Cebpe | CCAAT/enhancer binding protein (C/EBP), epsilon | 10090 | MGI:103572 | Inparanoid, OMA |
| Rat | 25410 | Cebpe | CCAAT/enhancer binding protein epsilon | 10116 | RGD:2329 | Inparanoid, OMA |
| Horse | 100052512 | CEBPE | CCAAT enhancer binding protein epsilon | 9796 | VGNC:16381 | Inparanoid, OMA |
| Cow | 534346 | CEBPE | CCAAT enhancer binding protein epsilon | 9913 | VGNC:27162 | Inparanoid, OMA |
| Anole lizard | 100554198 | cebpe | CCAAT/enhancer binding protein epsilon | 28377 | Inparanoid, OMA | |
| Xenopus | CEBPE | CCAAT/enhancer binding protein epsilon [Source:HGNC Symbol;Acc:HGNC:1836] | 8364 | OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / transcription factor / basic leucine zipper transcription factor / CCAAT/enhancer-binding protein epsilon
protein / transcription factor / nucleic acid binding / CCAAT/enhancer-binding protein epsilon
protein / transcription factor / basic leucine zipper transcription factor / CCAAT/enhancer-binding protein epsilon
protein / transcription factor / nucleic acid binding / CCAAT/enhancer-binding protein epsilon
DTO Classes
protein / Transcription factor / Basic leucine zipper transcription factor / CCAAT/enhancer-binding protein epsilon
protein / Transcription factor / Basic leucine zipper transcription factor / CCAAT/enhancer-binding protein epsilon
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.