🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

CD82

DescriptionCD82 antigen

Gene and Protein Information

Gene ID3732
Uniprot Accession IDs P27701 D3DQN6 E9PC70 Q7Z2D4 Q7Z5N2
Ensembl ID ENSP00000227155
Symbol KAI1 SAR2 ST6 TSPAN27 R2 4F9 C33 IA4 ST6 GR15 KAI1 SAR2 TSPAN27
FamilyBelongs to the tetraspanin (TM4SF) family.
Sequence
MGSACIKVTKYFLFLFNLIFFILGAVILGFGVWILADKSSFISVLQTSSSSLRMGAYVFIGVGAVTMLMGFLGCIGAVNEVRCLLGLYFAFLLLILIAQVTAGALFYFNMGKLKQEMGGIVTELIRDYNSSREDSLQDAWDYVQAQVKCCGWVSFYNWTDNAELMNRPEVTYPCSCEVKGEEDNSLSVRKGFCEAPGNRTQSGNHPEDWPVYQEGCMEKVQAWLQENLGIILGVGVGVAIIELLGMVLSICLCRHVHSEDYSKVPKY
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp741685CD82CD82 molecule9598VGNC:11290OMA, EggNOG
Macaque715606CD82CD82 molecule9544Inparanoid, OMA, EggNOG
Mouse12521Cd82CD82 antigen10090MGI:104651Inparanoid, OMA, EggNOG
Rat83628Cd82Cd82 molecule10116RGD:69070Inparanoid, OMA, EggNOG
Dog611384CD82CD82 molecule9615VGNC:38976Inparanoid, OMA, EggNOG
Horse100056000CD82CD82 molecule9796VGNC:16280Inparanoid, OMA, EggNOG
Cow506713CD82CD82 molecule9913VGNC:27049Inparanoid, OMA, EggNOG
Pig100270689CD82CD82 molecule9823Inparanoid, OMA, EggNOG
Opossum100011022CD82CD82 molecule13616Inparanoid, OMA, EggNOG
Platypus100075099CD82CD82 molecule9258Inparanoid, OMA, EggNOG
Anole lizard100555967cd82CD82 molecule28377Inparanoid, OMA, EggNOG
Xenopus394799cd82CD82 molecule8364XB-GENE-945242Inparanoid, OMA, EggNOG
Zebrafish324098cd82aCD82 molecule a7955ZDB-GENE-030131-2818Inparanoid, OMA
Zebrafish324137cd82bCD82 molecule b7955ZDB-GENE-030131-2857OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.