🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

CD83

DescriptionCD83 antigen

Gene and Protein Information

Gene ID9308
Uniprot Accession IDs Q01151 Q5THX9 hCD83
Ensembl ID ENSP00000368450
Symbol BL11 HB15
Sequence
MSRGLQLLLLSCAYSLAPATPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRAEIVLLLALVIFYLTLIIFTCKFARLQSIFPDFSKAGMERAFLPVTSPNKHLGLVTPHKTELV
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp462446CD83CD83 molecule9598VGNC:11041OMA, EggNOG
Macaque701825CD83CD83 molecule9544Inparanoid, OMA, EggNOG
Mouse12522Cd83CD83 antigen10090MGI:1328316Inparanoid, OMA, EggNOG
Rat361226Cd83CD83 molecule10116RGD:1309677Inparanoid, OMA, EggNOG
Dog610141CD83CD83 molecule9615VGNC:38977Inparanoid, OMA, EggNOG
HorseCD83CD83 molecule [Source:HGNC Symbol;Acc:HGNC:1703]9796OMA, EggNOG
Cow617034CD83CD83 molecule9913VGNC:27050Inparanoid, OMA, EggNOG
Pig100153365CD83CD83 molecule9823OMA, EggNOG
Opossum100026047CD83CD83 molecule13616Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.