🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

CRY2

DescriptionCryptochrome-2

Gene and Protein Information

Gene ID1408
Uniprot Accession IDs Q49AN0 B4DH32 B4DZD6 O75148 Q8IV71
Ensembl ID ENSP00000478187
Symbol KIAA0658 HCRY2 PHLL2
FamilyBelongs to the DNA photolyase class-1 family.
Sequence
MAATVATAAAVAPAPAPGTDSASSVHWFRKGLRLHDNPALLAAVRGARCVRCVYILDPWFAASSSVGINRWRFLLQSLEDLDTSLRKLNSRLFVVRGQPADVFPRLFKEWGVTRLTFEYDSEPFGKERDAAIMKMAKEAGVEVVTENSHTLYDLDRIIELNGQKPPLTYKRFQAIISRMELPKKPVGLVTSQQMESCRAEIQENHDETYGVPSLEELGFPTEGLGPAVWQGGETEALARLDKHLERKAWVANYERPRMNANSLLASPTGLSPYLRFGCLSCRLFYYRLWDLYKKVKRNSTPPLSLFGQLLWREFFYTAATNNPRFDRMEGNPICIQIPWDRNPEALAKWAEGKTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWVSWESGVRVFDELLLDADFSVNAGSWMWLSCSAFFQQFFHCYCPVGFGRRTDPSGDYIRRYLPKLKAFPSRYIYEPWNAPESIQKAAKCIIGVDYPRPIVNHAETSRLNIERMKQIYQQLSRYRGLCLLASVPSCVEDLSHPVAEPSSSQAGSMSSAGPRPLPSGPASPKRKLEAAEEPPGEELSKRARVAELPTPELPSKDA
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp742186CRY2cryptochrome circadian regulator 29598VGNC:3142OMA, EggNOG
Macaque715000CRY2cryptochrome circadian regulator 29544Inparanoid, OMA, EggNOG
Mouse12953Cry2cryptochrome 2 (photolyase-like)10090MGI:1270859Inparanoid, OMA, EggNOG
Rat170917Cry2cryptochrome circadian regulator 210116RGD:620935Inparanoid, OMA, EggNOG
Dog483641CRY2cryptochrome circadian regulator 29615VGNC:39634Inparanoid, OMA, EggNOG
Horse100056637CRY2cryptochrome circadian regulator 29796VGNC:16881Inparanoid, OMA, EggNOG
Cow509058CRY2cryptochrome circadian regulator 29913VGNC:27731OMA, EggNOG
Pig100517750CRY2cryptochrome circadian regulator 29823Inparanoid, OMA, EggNOG
Opossum100618618CRY2cryptochrome circadian regulator 213616Inparanoid, OMA, EggNOG
PlatypusCRY2cryptochrome circadian regulator 2 [Source:HGNC Symbol;Acc:HGNC:2385]9258OMA, EggNOG
Chicken374092CRY2cryptochrome circadian clock 29031CGNC:6396Inparanoid, OMA
Anole lizard100559432cry2cryptochrome circadian regulator 228377Inparanoid, OMA
S.cerevisiae854568PHR1deoxyribodipyrimidine photo-lyase PHR14932S000005913Inparanoid, EggNOG

Protein Classes

PANTHER Classes
protein    /    nucleic acid binding    /    DNA photolyase    /    Cryptochrome-2
protein    /    nucleic acid binding    /    lyase    /    Cryptochrome-2
DTO Classes
protein    /    Enzyme    /    Lyase    /    DNA photolyase    /    Cryptochrome-2

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.