ARF1

DescriptionADP-ribosylation factor 1

Gene and Protein Information

Gene ID375
Uniprot Accession IDs P84077 P10947 P32889
Ensembl ID ENSP00000440005
Symbol PVNH8
FamilyBelongs to the small GTPase superfamily. Arf family.
Sequence
MGNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQK
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp739225ARF1ADP ribosylation factor 19598VGNC:52940OMA, EggNOG
Mouse11840Arf1ADP-ribosylation factor 110090MGI:99431Inparanoid, OMA
Rat64310Arf1ADP-ribosylation factor 110116RGD:621270Inparanoid, OMA
Cow338058ARF1ADP ribosylation factor 19913VGNC:50209Inparanoid, OMA
Pig100301914ARF1ADP ribosylation factor 19823Inparanoid, OMA
Chicken420398ARF1ADP ribosylation factor 19031CGNC:51247Inparanoid, OMA
Anole lizard100552859arf1ADP ribosylation factor 128377Inparanoid, OMA
Xenopus394614arf5ADP ribosylation factor 58364XB-GENE-968852Inparanoid, OMA

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.