DAPP1

DescriptionDual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide

Gene and Protein Information

Gene ID27071
Uniprot Accession IDs Q9UN19 Q8TCK5 Q9UHF2 hDAPP1
Ensembl ID ENSP00000423602
Symbol BAM32 BAM32
Sequence
MGRAELLEGKMSTQDPSDLWSRSDGEAELLQDLGWYHGNLTRHAAEALLLSNGCDGSYLLRDSNETTGLYSLSVRAKDSVKHFHVEYTGYSFKFGFNEFSSLKDFVKHFANQPLIGSETGTLMVLKHPYPRKVEEPSIYESVRVHTAMQTGRTEDDLVPTAPSLGTKEGYLTKQGGLVKTWKTRWFTLHRNELKYFKDQMSPEPIRILDLTECSAVQFDYSQERVNCFCLVFPFRTFYLCAKTGVEADEWIKILRWKLSQIRKQLNQGEGTIRSRSFIFK
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp461398DAPP1dual adaptor of phosphotyrosine and 3-phosphoinositides 19598VGNC:10853OMA, EggNOG
Macaque709038DAPP1dual adaptor of phosphotyrosine and 3-phosphoinositides 19544Inparanoid, OMA, EggNOG
Mouse26377Dapp1dual adaptor for phosphotyrosine and 3-phosphoinositides 110090MGI:1347063Inparanoid, OMA, EggNOG
Rat362046Dapp1dual adaptor of phosphotyrosine and 3-phosphoinositides 110116RGD:1310189Inparanoid, OMA, EggNOG
Dog478491DAPP1dual adaptor of phosphotyrosine and 3-phosphoinositides 19615VGNC:39773Inparanoid, OMA, EggNOG
Horse100053857DAPP1dual adaptor of phosphotyrosine and 3-phosphoinositides 19796VGNC:17010Inparanoid, OMA, EggNOG
Cow533156DAPP1dual adaptor of phosphotyrosine and 3-phosphoinositides 19913VGNC:27880Inparanoid, OMA, EggNOG
Opossum100015430DAPP1dual adaptor of phosphotyrosine and 3-phosphoinositides 113616Inparanoid, OMA, EggNOG
PlatypusDAPP1dual adaptor of phosphotyrosine and 3-phosphoinositides 1 [Source:HGNC Symbol;Acc:HGNC:16500]9258OMA, EggNOG
Anole lizard100556013dapp1dual adaptor of phosphotyrosine and 3-phosphoinositides 128377Inparanoid, OMA, EggNOG
Xenopus548440dapp1dual adaptor of phosphotyrosine and 3-phosphoinositides8364XB-GENE-482064Inparanoid, OMA, EggNOG
Zebrafish550386dapp1dual adaptor of phosphotyrosine and 3-phosphoinositides7955ZDB-GENE-050417-180Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.