224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Cystatin-C |
|---|
Gene and Protein Information
| Gene ID | 1471 |
|---|---|
| Uniprot Accession IDs | P01034 B2R5J9 D3DW42 Q6FGW9 |
| Ensembl ID | ENSP00000381448 |
| Symbol | ARMD11 HEL-S-2 |
| Family | Belongs to the cystatin family. |
| Sequence | MAGPLRAPLLLLAILAVALAVSPAAGSSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Mouse | 13010 | Cst3 | cystatin C | 10090 | MGI:102519 | Inparanoid, OMA |
| Rat | 25307 | Cst3 | cystatin C | 10116 | RGD:2432 | Inparanoid, OMA, EggNOG |
| Dog | 607874 | LOC607874 | cystatin-C-like | 9615 | Inparanoid, OMA, EggNOG | |
| Horse | CST3 | cystatin C [Source:HGNC Symbol;Acc:HGNC:2475] | 9796 | OMA, EggNOG | ||
| Cow | 281102 | CST3 | cystatin C | 9913 | Inparanoid, OMA, EggNOG | |
| Anole lizard | 100554354 | cst11 | cystatin 11 | 28377 | OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.