224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | DDB1- and CUL4-associated factor 7 |
|---|
Gene and Protein Information
| Gene ID | 10238 |
|---|---|
| Uniprot Accession IDs | P61962 B4E039 D3DU14 O15491 Q9DAE4 |
| Ensembl ID | ENSP00000483236 |
| Symbol | HAN11 WDR68 AN11 HAN11 WDR68 SWAN-1 |
| Family | Belongs to the WD repeat DCAF7 family. |
| Sequence | MSLHGKRKEIYKYEAPWTVYAMNWSVRPDKRFRLALGSFVEEYNNKVQLVGLDEESSEFICRNTFDHPYPTTKLMWIPDTKGVYPDLLATSGDYLRVWRVGETETRLECLLNNNKNSDFCAPLTSFDWNEVDPYLLGTSSIDTTCTIWGLETGQVLGRVNLVSGHVKTQLIAHDKEVYDIAFSRAGGGRDMFASVGADGSVRMFDLRHLEHSTIIYEDPQHHPLLRLCWNKQDPNYLATMAMDGMEVVILDVRVPCTPVARLNNHRACVNGIAWAPHSSCHICTAADDHQALIWDIQQMPRAIEDPILAYTAEGEINNVQWASTQPDWIAICYNNCLEILRV Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Macaque | 720299 | DCAF7 | DDB1 and CUL4 associated factor 7 | 9544 | Inparanoid, OMA | |
| Mouse | 71833 | Dcaf7 | DDB1 and CUL4 associated factor 7 | 10090 | MGI:1919083 | Inparanoid, OMA |
| Rat | 303602 | Dcaf7 | DDB1 and CUL4 associated factor 7 | 10116 | RGD:1305140 | Inparanoid, OMA |
| Dog | 100856670 | DCAF7 | DDB1 and CUL4 associated factor 7 | 9615 | VGNC:39796 | Inparanoid, OMA |
| Horse | 100054273 | DCAF7 | DDB1 and CUL4 associated factor 7 | 9796 | VGNC:17033 | Inparanoid, OMA |
| Pig | 100514182 | DCAF7 | DDB1 and CUL4 associated factor 7 | 9823 | Inparanoid, OMA | |
| Opossum | 100021497 | DCAF7 | DDB1 and CUL4 associated factor 7 | 13616 | Inparanoid, OMA | |
| Chicken | 771554 | DCAF7 | DDB1 and CUL4 associated factor 7 | 9031 | CGNC:313 | Inparanoid, OMA |
| Anole lizard | 100564062 | dcaf7 | DDB1 and CUL4 associated factor 7 | 28377 | Inparanoid, OMA | |
| Xenopus | 394701 | dcaf7 | DDB1 and CUL4 associated factor 7 | 8364 | XB-GENE-973762 | Inparanoid, OMA |
| Zebrafish | 337565 | dcaf7 | ddb1 and cul4 associated factor 7 | 7955 | ZDB-GENE-030131-9511 | Inparanoid, OMA |
| C. elegans | 179875 | swan-2 | Seven WD repeats, AN11 family | 6239 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.