224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | DDB1- and CUL4-associated factor 13 |
|---|
Gene and Protein Information
| Gene ID | 25879 |
|---|---|
| Uniprot Accession IDs | Q9NV06 Q3MII9 Q8NCH8 Q8TC51 Q96JY7 Q9NZX3 |
| Ensembl ID | ENSP00000297579 |
| Symbol | WDSOF1 GM83 Sof1 WDSOF1 HSPC064 |
| Family | Belongs to the WD repeat DCAF13/WDSOF1 family. |
| Sequence | MKVKMLSRNPDNYVRETKLDLQRVPRNYDPALHPFEVPREYIRALNATKLERVFAKPFLASLDGHRDGVNCLAKHPEKLATVLSGACDGEVRIWNLTQRNCIRTIQAHEGFVRGICTRFCGTSFFTVGDDKTVKQWKMDGPGYGDEEEPLHTILGKTVYTGIDHHWKEAVFATCGQQVDIWDEQRTNPICSMTWGFDSISSVKFNPIETFLLGSCASDRNIVLYDMRQATPLKKVILDMRTNTICWNPMEAFIFTAANEDYNLYTFDMRALDTPVMVHMDHVSAVLDVDYSPTGKEFVSASFDKSIRIFPVDKSRSREVYHTKRMQHVICVKWTSDSKYIMCGSDEMNIRLWKANASEKLGVLTSREKAAKDYNQKLKEKFQHYPHIKRIARHRHLPKSIYSQIQEQRIMKEARRRKEVNRIKHSKPGSVPLVSEKKKHVVAVVK Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 464328 | DCAF13 | DDB1 and CUL4 associated factor 13 | 9598 | VGNC:896 | OMA, EggNOG |
| Mouse | 223499 | Dcaf13 | DDB1 and CUL4 associated factor 13 | 10090 | MGI:2684929 | Inparanoid, OMA, EggNOG |
| Rat | 362902 | Dcaf13 | DDB1 and CUL4 associated factor 13 | 10116 | RGD:1308458 | Inparanoid, OMA, EggNOG |
| Dog | 475065 | DCAF13 | DDB1 and CUL4 associated factor 13 | 9615 | VGNC:39791 | Inparanoid, OMA, EggNOG |
| Horse | 100062586 | DCAF13 | DDB1 and CUL4 associated factor 13 | 9796 | VGNC:17028 | Inparanoid, OMA, EggNOG |
| Cow | 100138632 | DCAF13 | DDB1 and CUL4 associated factor 13 | 9913 | VGNC:53857 | OMA, EggNOG |
| Pig | 100155764 | DCAF13 | DDB1 and CUL4 associated factor 13 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100024061 | DCAF13 | DDB1 and CUL4 associated factor 13 | 13616 | Inparanoid, OMA, EggNOG | |
| Anole lizard | 100551867 | dcaf13 | DDB1 and CUL4 associated factor 13 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 407967 | dcaf13 | DDB1 and CUL4 associated factor 13 | 8364 | XB-GENE-5791289 | Inparanoid, EggNOG |
| Zebrafish | 393097 | dcaf13 | ddb1 and cul4 associated factor 13 | 7955 | ZDB-GENE-040426-703 | Inparanoid, OMA, EggNOG |
| Fruitfly | 39669 | CG7275 | CG7275 gene product from transcript CG7275-RA | 7227 | FBgn0036500 | Inparanoid, EggNOG |
| S.cerevisiae | 850649 | SOF1 | rRNA-processing protein SOF1 | 4932 | S000003934 | Inparanoid, OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / nucleic acid binding / RNA binding protein / DDB1- and CUL4-associated factor 13
protein / nucleic acid binding / RNA binding protein / DDB1- and CUL4-associated factor 13
DTO Classes
protein / Nucleic acid binding / RNA binding protein / DDB1- and CUL4-associated factor 13
protein / Nucleic acid binding / RNA binding protein / DDB1- and CUL4-associated factor 13
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.