🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

DNAI1

DescriptionDynein intermediate chain 1, axonemal

Gene and Protein Information

Gene ID27019
Uniprot Accession IDs Q9UI46 B7Z7U1 Q5T8G7 Q8NHQ7 Q9UEZ8
Ensembl ID ENSP00000480538
Symbol PCD DIC1 ICS1 CILD1
FamilyBelongs to the dynein intermediate chain family.
Sequence
MIPASAKAPHKQPHKQSISIGRGTRKRDEDSGTEVGEGTDEWAQSKATVRPPDQLELTDAELKEEFTRILTANNPHAPQNIVRYSFKEGTYKPIGFVNQLAVHYTQVGNLIPKDSDEGRRQHYRDELVAGSQESVKVISETGNLEEDEEPKELETEPGSQTDVPAAGAAEKVTEEELMTPKQPKERKLTNQFNFSERASQTYNNPVRDRECQTEPPPRTNFSATANQWEIYDAYVEELEKQEKTKEKEKAKTPVAKKSGKMAMRKLTSMESQTDDLIKLSQAAKIMERMVNQNTYDDIAQDFKYYDDAADEYRDQVGTLLPLWKFQNDKAKRLSVTALCWNPKYRDLFAVGYGSYDFMKQSRGMLLLYSLKNPSFPEYMFSSNSGVMCLDIHVDHPYLVAVGHYDGNVAIYNLKKPHSQPSFCSSAKSGKHSDPVWQVKWQKDDMDQNLNFFSVSSDGRIVSWTLVKRKLVHIDVIKLKVEGSTTEVPEGLQLHPVGCGTAFDFHKEIDYMFLVGTEEGKIYKCSKSYSSQFLDTYDAHNMSVDTVSWNPYHTKVFMSCSSDWTVKIWDHTIKTPMFIYDLNSAVGDVAWAPYSSTVFAAVTTDGKAHIFDLAINKYEAICNQPVAAKKNRLTHVQFNLIHPIIIVGDDRGHIISLKLSPNLRKMPKEKKGQEVQKGPAVEIAKLDKLLNLVREVKIKT
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp465060DNAI1dynein axonemal intermediate chain 19598VGNC:8816OMA, EggNOG
Macaque701307DNAI1dynein axonemal intermediate chain 19544Inparanoid, OMA, EggNOG
Mouse68922Dnaic1dynein, axonemal, intermediate chain 110090MGI:1916172Inparanoid, OMA, EggNOG
Rat500442Dnai1dynein, axonemal, intermediate chain 110116RGD:1565671Inparanoid, OMA
Dog474749DNAI1dynein axonemal intermediate chain 19615VGNC:40020Inparanoid, OMA, EggNOG
Horse100068649DNAI1dynein axonemal intermediate chain 19796VGNC:17241Inparanoid, OMA, EggNOG
Cow524709DNAI1dynein axonemal intermediate chain 19913VGNC:28129Inparanoid, OMA, EggNOG
Opossum100028940DNAI1dynein axonemal intermediate chain 113616Inparanoid, OMA, EggNOG
Chicken431654DNAI1dynein axonemal intermediate chain 19031CGNC:4353OMA, EggNOG
Zebrafish555705dnai1.2dynein, axonemal, intermediate chain 1, paralog 27955ZDB-GENE-070112-1302OMA, EggNOG
Fruitfly37374CG9313CG9313 gene product from transcript CG9313-RC7227FBgn0034566Inparanoid, EggNOG

Protein Classes

PANTHER Classes
protein    /    cytoskeletal protein    /    microtubule family cytoskeletal protein    /    Dynein intermediate chain 1, axonemal
DTO Classes
protein    /    Cellular structure    /    Microtubule family cytoskeletal protein    /    Dynein intermediate chain 1, axonemal

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.