ECM1

DescriptionExtracellular matrix protein 1

Gene and Protein Information

Gene ID1893
Uniprot Accession IDs Q16610 A8K8S0 B4DW49 B4DY60 O43266 Q5T5G4 Q5T5G5 Q5T5G6 Q8IZ60
Ensembl ID ENSP00000358045
Symbol URBWD
Sequence
MGTTARAALVLTYLAVASAASEGGFTATGQRQLRPEHFQEVGYAAPPSPPLSRSLPMDHPDSSQHGPPFEGQSQVQPPPSQEATPLQQEKLLPAQLPAEKEVGPPLPQEAVPLQKELPSLQHPNEQKEGTPAPFGDQSHPEPESWNAAQHCQQDRSQGGWGHRLDGFPPGRPSPDNLNQICLPNRQHVVYGPWNLPQSSYSHLTRQGETLNFLEIGYSRCCHCRSHTNRLECAKLVWEEAMSRFCEAEFSVKTRPHWCCTRQGEARFSCFQEEAPQPHYQLRACPSHQPDISSGLELPFPPGVPTLDNIKNICHLRRFRSVPRNLPATDPLQRELLALIQLEREFQRCCRQGNNHTCTWKAWEDTLDKYCDREYAVKTHHHLCCRHPPSPTRDECFARRAPYPNYDRDILTIDIGRVTPNLMGHLCGNQRVLTKHKHIPGLIHNMTARCCDLPFPEQACCAEEEKLTFINDLCGPRRNIWRDPALCCYLSPGDEQVNCFNINYLRNVALVSGDTENAKGQGEQGSTGGTNISSTSEPKEE
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp746939ECM1extracellular matrix protein 19598VGNC:1232OMA, EggNOG
Macaque707209ECM1extracellular matrix protein 19544Inparanoid, OMA, EggNOG
Mouse13601Ecm1extracellular matrix protein 110090MGI:103060Inparanoid, OMA, EggNOG
Rat116662Ecm1extracellular matrix protein 110116RGD:620357Inparanoid, OMA, EggNOG
Horse100054714ECM1extracellular matrix protein 19796VGNC:17409Inparanoid, OMA, EggNOG
Cow524222ECM1extracellular matrix protein 19913VGNC:28311Inparanoid, OMA, EggNOG
Pig100620701ECM1extracellular matrix protein 19823Inparanoid, OMA, EggNOG
OpossumECM1extracellular matrix protein 1 [Source:HGNC Symbol;Acc:HGNC:3153]13616Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.