🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA Structure
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

GEMIN2

DescriptionGem-associated protein 2

Gene and Protein Information

Gene ID8487
Uniprot Accession IDs O14893 B2R9W8 Q2M3B3 Q9H4F5 Q9NS77 Q9NS78 Q9NS79 Gemin-2
Ensembl ID ENSP00000308533
Symbol SIP1 SIP1 SIP1-delta
FamilyBelongs to the gemin-2 family.
Sequence
MRRAELAGLKTMAWVPAESAVEELMPRLLPVEPCDLTEGFDPSVPPRTPQEYLRRVQIEAAQCPDVVVAQIDPKKLKRKQSVNISLSGCQPAPEGYSPTLQWQQQQVAQFSTVRQNVNKHRSHWKSQQLDSNVTMPKSEDEEGWKKFCLGEKLCADGAVGPATNESPGIDYVQIGFPPLLSIVSRMNQATVTSVLEYLSNWFGERDFTPELGRWLYALLACLEKPLLPEAHSLIRQLARRCSEVRLLVDSKDDERVPALNLLICLVSRYFDQRDLADEPS
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp452873GEMIN2gem nuclear organelle associated protein 29598VGNC:3418OMA, EggNOG
Macaque698881GEMIN2gem nuclear organelle associated protein 29544OMA, EggNOG
Mouse66603Gemin2gem nuclear organelle associated protein 210090MGI:1913853Inparanoid, OMA, EggNOG
Rat84404Gemin2gem (nuclear organelle) associated protein 210116RGD:620842Inparanoid, OMA
Dog610087GEMIN2gem nuclear organelle associated protein 29615VGNC:41173Inparanoid, OMA, EggNOG
Horse100060834GEMIN2gem nuclear organelle associated protein 29796VGNC:18302Inparanoid, OMA, EggNOG
Cow510259GEMIN2gem nuclear organelle associated protein 29913VGNC:29316Inparanoid, OMA, EggNOG
Pig100525675GEMIN2gem nuclear organelle associated protein 29823OMA, EggNOG
Opossum100029358GEMIN2gem nuclear organelle associated protein 213616Inparanoid, EggNOG
Platypus100083035GEMIN2gem nuclear organelle associated protein 29258OMA, EggNOG
Chicken423336GEMIN2gem nuclear organelle associated protein 29031CGNC:7719Inparanoid, OMA, EggNOG
Anole lizard100559033gemin2gem nuclear organelle associated protein 228377Inparanoid, OMA, EggNOG
Xenopus100124782gemin2gem nuclear organelle associated protein 28364XB-GENE-941786OMA, EggNOG
Zebrafish550271gemin2gem (nuclear organelle) associated protein 27955ZDB-GENE-030131-3756Inparanoid, OMA, EggNOG
C. elegans189726smi-1SMN (survival of motor neuron) protein Interactor6239Inparanoid, OMA, EggNOG
Fruitfly40087Gem2Gemin27227FBgn0036850Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    nucleic acid binding    /    mRNA splicing factor    /    Gem-associated protein 2
DTO Classes
protein    /    Nucleic acid binding    /    RNA binding protein    /    mRNA processing factor    /    mRNA splicing factor    /    Gem-associated protein 2

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.